Genome-wide identification and classification of the Hsf and sHsp gene families in Prunus mume, and transcriptional analysis under heat stress

View article
Bioinformatics and Genomics

Introduction

As sessile organisms, plants are unavoidably exposed to heat stress (HS). HS disturbs plant cellular homeostasis, which results in additional injuries. To relieve these adverse effects, higher plants have developed many responses to HS (Mittler, Finka & Goloubinoff, 2012). The accumulation of heat shock proteins (Hsps) is regulated by heat shock transcription factors (Hsfs), which play crucial roles in the HS response (HSR) and confer thermo-tolerance to plants and other organisms (Kotak et al., 2007; Ohama et al., 2016). Plant Hsfs contain at least two functional domains. All plant Hsfs share a DNA-binding domain (DBD) at the N-terminus and an adjacent oligomerization domain (OD or HR-A/B), as well as nuclear localization signal (NLS) motifs (Scharf et al., 2012). The most conserved part of Hsfs is the DBD, which has a conformation containing a three-helix bundle and a four-stranded antiparallel β-sheet that ensures its specific interactions with HS promoter elements. The amino acid sequence of the OD contains a heptad repeat pattern of hydrophobic amino acid residues. Three plant Hsf classes are distinguished based on the number of amino acid residues between two heptad repeats. There are 21 amino acid residues in class A Hsfs, 7 in class C, and none in class B (Nover et al., 2001). Class A Hsfs function in transcription activation through AHA motifs, which are made up of aromatic, hydrophobic, and acidic amino acid residues, while these do not appear in class B and C Hsfs (Döring et al., 2000; Kotak et al., 2004). Additionally, there is a repressor domain with an LFGV motif in the C-terminal domain of Class B Hsfs.

Plant Hsps are grouped into five families based on their approximate molecular weights: Hsp100, Hsp90, Hsp70, Hsp60, and small Hsp (sHsp) (Wang et al., 2004). Most Hsp families (i.e., Hsp100, Hsp90, Hsp70, and Hsp60) are highly conserved across great organismal distance, and are among the most highly conserved protein families known (Stechmann & Cavalier-Smith, 2003; Waters, Aevermann & Sanders-Reed, 2008). Although the monomers of plant sHsp proteins are the smallest among Hsps (12–40 kDa), plant sHsps exhibit high diversity in amino acid sequence (Hilton et al., 2013; Mani, Ramakrishna & Suguna, 2015). Except for the conserved α-crystallin domain (ACD) near the C-terminus, the N- and C-terminal extensions are variable (Kriehuber et al., 2010; Haslbeck & Vierling, 2015). Despite the long evolutionary histories of many sHsp subfamilies, the sHsp family continues to expand within different angiosperm lineages (Waters, Aevermann & Sanders-Reed, 2008).

The ACD represents the conservative signature motif of sHsps, and consists of two antiparallel β-sheets (Van Montfort et al., 2001; Van Montfort, Slingsby & Vierling, 2002; Delbecq & Klevit, 2013). In addition to the diversity in their sequences, the plant sHsps are found in different subcellular locations, including the cytosol/nucleus (C), chloroplast (CP), endoplasmic reticulum (ER), mitochondria (MT), and peroxisome (PX). According to their cellular localization and sequence similarity, plant sHsps are fall into 11 subfamilies: subfamilies CI to CVI, subfamily CP, subfamily ER, subfamilies MTI and MTII, and subfamily PX (Waters, 2013).

Recently, Hsfs and sHsps have been identified from several higher plants. For example, 24 Hsfs have been identified in Arabidopsis (Nover et al., 2001), 24 in tomato (Scharf et al., 2012), 27 in poplar (Zhang et al., 2015a), 40 in cotton (Wang et al., 2014), 27 in willow (Zhang et al., 2015a), 25 in rice (Scharf et al., 2012), and 56 in wheat (Xue et al., 2014). Additionally, 19, 33, 37, 94, 23, and 27 sHsps have been identified in Arabidopsis (Scharf, Siddique & Vierling, 2001), tomato (Arce et al., 2018), poplar (Zhang et al., 2015b), cotton (Ma et al., 2016), rice (Sarkar, Kim & Grover, 2009), and wheat (Pandey et al., 2015), respectively. This reveals that the number of different Hsfs and sHsps varies among plant species, which may be the result of gene duplication and whole-genome duplication (WGD).

Under high temperature stress, plant Hsfs have two expression patterns: constitutive and induced expression. The mRNA levels of Arabidopsis HsfA2, B1, A4a, B2a, B2b, and A7a are significantly increased after HS, while the mRNA levels of the other Hsfs appear to be unchanged when comparing the control and HS conditions (Busch, Wunderlich & Schöffl, 2005). In maize, the transcription levels of five ZmHsfs do not change under HS, while 12 ZmHsfs are up-regulated (Lin et al., 2011). In contrast to the expression patterns of plant sHsfs, almost all plant sHsps are heat-inducible (Waters, 2013).

Prunus mume is an important ornamental plant in China. We previously detected the expression of PmHSP17.9, an sHsp of P. mume, under abiotic stresses, and its overexpression in Arabidopsis can improve heat tolerance and superoxide dismutase activity (Wan et al., 2016). In this study, we identified 18 members of the Hsf family and 24 members of the sHsp family based on the P. mume genome. Then, we conducted comprehensive analyses of the gene chromosomal locations, structures, phylogeny, and conserved motifs. To examine their potential roles, we investigated the expression patterns of the Hsf and sHsp genes in response to HS. The results of this study provide an overview of the PmHsf and PmsHsp genes, and lay the foundation for further functional analyses of these genes in response to HS.

Material and Methods

Identification and chromosomal locations of Hsf and sHsp members in P. mume

The genome, transcript, and protein sequences were accessed from the P. mume genome (V1.0) (https://www.ncbi.nlm.nih.gov/genome/?term=13911). To identify all potential Hsfs in P. mume, Arabidopsis Hsf protein sequences were retrieved from the Arabidopsis Information Resource (http://www.arabidopsis.org) and were used as queries to perform BLAST searches against the P. mume genome database to identify results with e-values less than 0.0001. To identify sHsp members, the P. mume genome annotation database was searched with the keyword “alpha crystallin protein.” Then, the putative sHsp sequences were used as queries in NCBI BLAST searches. Next, the sequences were manually analyzed to exclude duplicated annotations in the NCBI database.

The locations of the Hsf and sHsp members on the P. mume chromosomes were obtained from the P. mume genome data. PmHsfs or PmsHsps were numbered (1, 2, 3, etc.) according to their order on the chromosomes. Finally, chromosome location graphics for the Hsfs and sHsps were generated using MapInspect software.

Gene structure and conserved motif analysis

Exon–intron structure information was obtained from the P. mume genome database. The gene structures of the Hsf or sHsp members were generated on the Gene Structure Display Server 2.0 (http://gsds.cbi.pku.edu.cn). Then, the theoretical isoelectric points and molecular weights were estimated using the ExPASy software (http://web.expasy.org). Finally, the conserved motifs of the Hsf or sHsp proteins were analyzed by submitting their full-length amino acid sequences to the MEME 5.0.5 online tool (http://meme-suite.org/tools/meme) (Bailey et al., 2006). The parameters used were as follows: number of repetitions: any; maximum number of motifs: 30 for Hsfs and 10 for sHsps; the other parameters used the default settings.

Phylogenetic analysis

To further understand the evolutionary relationships of the Hsf and sHsp proteins, phylogenetic trees were constructed based on the complete protein sequences of the Hsfs or sHsps from P. mume using the MEGA 5.0 software with its default settings using the neighbor-joining method (Saitou & Nei, 1987). The evolutionary distances between the PmHsf or PmsHsp sequence pairs were computed using the ClustalW tool. Bootstrap value analysis was performed using 1,000 replicates to assess the level of statistical support at each node.

Plant material and growth conditions

Dormant cuttings with five buds each were harvested from three 5-year-old P. mume “Xue Mei” trees at the Huazhong Agricultural University (Wuhan, China). Next, the lower ends of the cuttings were inserted in 20 mL of distilled water in a phytotron with a 14-h photoperiod, a light intensity of 120 μmol m−2s−1, and a temperature of 24 °C until leaf expansion of one to two cm length occurred. Cuttings with well-expanded shoots were transferred into a chamber and subjected to 42 °C HS. The leaves were harvested after 1, 2, 4, 8, and 12 h of HS, and leaves in the phytotron at 24 °C were used as a negative control. All samples were frozen immediately in liquid nitrogen and stored at −80 °C until RNA extraction.

RNA isolation and quantitative reverse transcription PCR analysis

Total RNA was extracted using the EASYspin Rapid Plant RNA Extraction Kit (RN09; Aidlab Biotechnologies, Beijing, China), and RNase-free DNase I (Qiagen, Valencia, CA, USA) was used to remove any contamination of genomic DNA according to the manufacturer’s protocol. First-strand cDNA synthesis was carried out with one μg of total RNA using the PrimeScript® RT Reagent Kit (DRR047A; TaKaRa, Shiga, Japan).

Gene-specific oligonucleotide primers (Table S1) were designed using the Primer Premier 5 software. Each qRT-PCR primer pair was tested by end-point PCR to show that they produced a specific product of predicted size. Primer efficiencies were not calculated. Water was used as non-template control to detect the presence of any contaminating DNA. qRT-PCR was performed using the ABI 7500 Fast Real-Time PCR System (Applied Biosystems, Foster City, CA, USA) using SYBR® Premix Ex Taq™ II (Tli RNaseH Plus; Takara, Dalian, China). The PCR cycling protocol was as follows: 95 °C for 30 s followed by 40 cycles of 95 °C for 3 s and 60 °C for 30 s. The transcriptional expression levels were determined using the 2−∆∆CT method (Schmittgen & Livak, 2008). The eukaryotic translational elongation factor 1 alpha (PmEF1α) gene of P. mume (previously published in the past study) was used as the reference gene (Guo et al., 2014). Three biological and technical replicates for each reaction were performed. A total of 0.5 cycles range in Cq value was acceptable within a single technical triplicate. Statistical significance was determined by one-way analysis of variance using SPSS ver. 19.0 software (IBM Corp., Armonk, NY, USA). Differences were considered to be significant at p < 0.05.

Results

Identification and chromosomal locations of the Hsf and sHsp genes in P. mume

Through automated database searching and manual checks, 18 nonredundant Hsf and 24 sHsp genes were identified from the P. mume genome database. Detailed information, such as gene IDs, coding sequence length, number of amino acids, and molecular weight, is provided in Table S2, Figs. S1 and S2.

To determine their distribution in the P. mume genome, the locations of the Hsf and sHsp genes were mapped onto the P. mume chromosomes, and the genes were designated as PmHsf1-18 and PmsHsp1-24 based on the order of their locations on the chromosomes (Fig. 1). PmHsf18 was anchored on un-assembled scaffold272, whereas all of the remaining Hsf genes were distributed on chromosomes 2–8. The numbers of Hsf genes on each chromosome were uneven: chromosomes 2, 8, 3, and 7 contained five, four, three, and two Hsf genes, respectively; and chromosomes 4, 5, and 6 harbored only one Hsf gene each (Fig. 1A). PmsHsp23 and PmsHsp24 were located at scaffold56 and scaffold265, respectively. Furthermore, no sHsp genes were detected on chromosome 6, whereas the highest number of sHsp genes was located on chromosome 1 (Fig. 1B).

Locations of Hsf and sHsp genes on the Prunus mume chromosomes.

Figure 1: Locations of Hsf and sHsp genes on the Prunus mume chromosomes.

(A) Locations of 18 Hsf genes on the P. mume chromosomes. (B) Locations of 24 sHsp genes on the P. mume chromosomes. The scale represents megabases (Mb). The chromosome numbers are indicated at the top of each bar.

Phylogenetic analysis of the Hsf and sHsp proteins from P. mume and Arabidopsis

To evaluate the phylogenetic relationships of the Hsf or sHsp proteins in depth, phylogenetic trees were constructed based on the full-length amino acid sequences of the proteins from P. mume and Arabidopsis (Figs. 2 and 3). The PmHsf family clearly grouped into three major classes (A, B, and C). Class A contained 11 Hsf genes, and was further subdivided into nine distinct subfamilies (A1–A9). Class B contained six Hsfs, and was classified into four subfamilies (B1–B4). Class C Hsf constituted one distinct clade, which appeared more closely related to the Hsf A group (Fig. 2).

Phylogenetic trees and exon-intron structures for PmHsf and Arabidopsis Hsf families.

Figure 2: Phylogenetic trees and exon-intron structures for PmHsf and Arabidopsis Hsf families.

The phylogenetic trees were obtained using the MEGA 5.0 software on the basis of the complete protein sequences. Bootstrap values > 50 are shown. Exons are indicated by black boxes. Introns are represented by black lines.
Phylogenetic trees and exon-intron structures for PmsHsp and Arabidopsis sHsp families.

Figure 3: Phylogenetic trees and exon-intron structures for PmsHsp and Arabidopsis sHsp families.

The phylogenetic trees were obtained using the MEGA 5.0 software on the basis of the complete protein sequences. Bootstrap values > 50 are shown. C, cytoplasmic/nuclear; ER, endoplasmic reticulum; P, plastids; M, mitochondria; CI(r), CI related; P(r), P related. Exons are indicated by black boxes. Introns are represented by black lines.

The phylogenetic analysis revealed that the sHsp family could be classified into cytoplasmic/nuclear (CI, CII, and CIII), plastid (P), ER, mitochondrial (M), CI(r) (CI-related), and P(r) (P-related) subfamilies in P. mume. However, there were some differences between the phylogenetic analysis and the annotations. For example, PmsHsp23 (annotated as M) grouped into the P(r) subfamily. Additionally, PmsHsp10 and PmsHsp16 (annotated as class CI) grouped into the ER subfamily, whereas PmHsp15 (annotated as CV) and PmHsp24 (annotated as CVI) grouped into the CI(r) subfamily. Notably, many sHsps grouped to class CI, CI(r), CII, and CIII, located in the cytosol/nucleus, suggesting that the cytosol may be the main functional location for PmsHsps (Fig. 3).

Analyses of gene structure, conserved domains, and motifs

In an effort to gain deeper insights into the structural differences between the Hsf and sHsp genes in P. mume, the exon–intron structures of Hsf and sHsp genes were analyzed (Figs. 2 and 3; Table S2). All of the Hsf genes contained only one intron, which had a position that was highly conserved, except for PmHsf2, which contained two introns. The length of the introns varied among the Hsf genes: for example, PmHsf12 and PmHsf17 had the smallest intron (92 bp), and PmHsf4 had the longest intron (3,196 bp). However, the number and location of the introns varied among the sHsp genes (Fig. 3). Most sHsp genes contained no introns or only one intron, whereas PmsHsp18 contained two introns. The largest number of introns was found in PmsHsp2, which contained four introns (Fig. 3).

The known elements of the functional domains of AtHsf allowed for the study of similar domains in the 18 PmHsfs (Table 1). Five conserved domains (DBD, HR-A/B region, NLS, nuclear export signal (NES), and AHA motifs) were observed in most of the PmHsf proteins. Multiple alignments revealed that the highly conserved DBD of approximately 100 amino acids was located close to the N-terminus in all of the PmHsfs (Table 1; Fig. 4A). Interestingly, PmHsf14 and PmHsf16 contained a long N-terminus (102 and 143 amino acids, respectively), whereas most Hsfs had a short N-terminus (Fig. S1). The HR-A/B regions of the PmHsfs were consistently observed with the predicted coiled-coil structure (Table 1; Fig. 4B). Two clusters of basic amino acid residues (K/R), which are found in nearly all PmHsf proteins, may contribute to the potential NLS motif (Lyck et al., 1997). As expected, most Hsf proteins contained the putative NES (Table 1), composed of hydrophobic, frequently leucine-rich amino acid residues (La Cour et al., 2004). Meanwhile, the putative AHA motifs were located in the center of the CTAD for most class A PmHsfs, with variable lengths and richness in F, W, D, and L amino acid residues (Table 1).

Table 1:
Functional domains of non-redundant Hsfs in P. mume.
Name Type DBD Linker (bp) HR-A/B NLS NES AHA motifs
PmHsf8 HsfA1 18–111 36 148–198 (215) NRR 5 KKRRLPR (489) ITEQMELL (439) DIFWEQFLPA
PmHsf12 HsfA1 36–129 36 166–216 (233) NRR 5 KKRRLK (500) LTEKMERL (457) WDQFLQ
PmHsf2 HsfA2 39–132 29 162–212 (223) EKKARNKE 7 RKRR (279) ETFFSAAALD (315) WEELWSDE
PmHsf14 HsfA3 102–195 24 220–270 (292) RMKRK (322) AWRNLS (366) DVASDELNLS (493) DIGPLHAAG
PmHsf7 HsfA4 11–104 33 138–188 (206) RKRRLPR (399) LTEQMGHL (250) LTFWEDTIFD (348) DVFWEHFLTE
PmHsf9 HsfA4 11–104 31 138–186 (203) NKKRR (426) FTNQIGRL (252) LNFWEDFLHG (376) DMFWEQCLTE
PmHsf4 HsfA5 13–106 26 133–183 (206) KKRR (478) AETLTL (431) DVFWEQFLTE
PmHsf5 HsfA6 31–124 29 154–204 (217) KDKRN 7 KKRRR (343) FVEELVYL (293) DEEECMEKEEGN (336) EDEDVDV
PmHsf11 HsfA7 41–134 29 164–214 (227) KDKRK 7 KKRRR (328) LADRLGYL (302) DEESERFEGDL (321) EDEDVII
PmHsf3 HsfA8 18–111 35 147–197 (328) KEDGK (387) ITEQMGYL (308) DGAWEQLLLA (350) ESQNFDTLIE
PmHsf16 HsfA9 143–235 25 261–311 (323) KRVIKR 7 RKRRR (355) DTSLSVDCG
PmHsf15 HsfB1 7–100 61 162–191 (245) DEKKK
PmHsf6 HsfB2 16–115 40 156–185
PmHsf10 HsfB2 24–117 56 174–203 (248) KRARE
PmHsf13 HsfB2 29–122 69 192–221 (291) KRVRR
PmHsf18 HsfB3 19–112 52 165–194 (180) KRKCK (208) PKLFGVRL
PmHsf1 HsfB4 22–115 96 212–241 (335) KNTK 9 KKR (379) LGLHLM
PmHsf17 HsfC1 9–102 35 138–174 (198) KKRR
DOI: 10.7717/peerj.7312/table-1
Multiple sequence alignment of the DBD domains and HR-A/B regions of the Hsf proteins in P. mume.

Figure 4: Multiple sequence alignment of the DBD domains and HR-A/B regions of the Hsf proteins in P. mume.

(A) Multiple sequence alignment of the DBD domains of the Hsf proteins in P. mume. The multiple alignment results clearly show the highly conserved DBD domains among P. mume Hsf genes. The secondary structure elements of DBD (α1-β1-β2-α2-α3-β3-β4) are shown above the alignment. Cylindrical tubes represent α-helices and block arrows represent β-sheets. (B) Multiple sequence alignment of the HR-A B regions of the Hsf proteins in P. mume. The scheme at the top depicts the locations and boundaries of the HR-A core, insert, and HR-B regions within the HR-A/B regions. The structures between HR-A and HR-B consist of 21 amino acid and seven amino acid insertions, respectively, for Class A and C.

The conserved motif distributions were searched using the MEME web server to obtain more insights into the predicted domains and the diversity of the motif compositions (Fig. 5; Table 2). Motifs 1, 2, and 3 represented the Hsf DBD domains (Table 2). Motif 4 indicated that the HR-A/B region and was found in all Hsfs, whereas class A proteins also exhibited the motif 5-type HR-A/B region. Motifs 9 and 22 represented the NLS domain, which was widely distributed in the PmHsf family. Furthermore, motifs 10 and 6 represented NES and AHA motifs, respectively. Overall, the MEME motifs indicated that the PmHsfs contained putative conserved domains.

Distribution of conserved motifs in the Hsf family members in P. mume.

Figure 5: Distribution of conserved motifs in the Hsf family members in P. mume.

All motifs were identified by MEME 5.0.5 using the complete amino acid sequences. Motif sizes are indicated at the bottom of the figure. Different motifs are indicated by different colors numbered 1–30. For details of motifs refer to Table 2.
Table 2:
Hsf motif sequences identified in P. mume by MEME tools.
Motif Multilevel consensus sequence
1 FVVWBPPEFARDLLPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGF
2 LHRSGPPPFLTKTYDLVDDPSTDDIVSW
3 RGQKHLLKNIHRRKP
4 LEEEIERLKKDKSVLMQELVRLRQQQQNT
5 NQLQALEZRLQGMEQKQQQMMSFLAKALQNPGFLQQLVQK
6 PPGVNDVFWEQFLTESPGLEDAZE
7 DGQIVKYQPPVNEAAKAMLRQI
8 GACVEVGKFG
9 HNKKRRLP
10 WWSTQNVDNJTEQMGRLTS
11 IHSHSHQQ
12 AISSICHNVDFRPKSPGIDMN
13 YFVQNCVK
14 PKLFGV
15 FWEDFJFGIGEAH
16 TNAKKCPPLEFGDCDHEM
17 GYLGHC
18 CHSATI
19 IRSCTV
20 YNKNPTVGCV
21 PSNSGEEQVISSSSSP
22 QNENNRRI
23 MEGVCDQ
24 EVNPEYVECFQ
25 MDYLKP
26 EAFCIK
27 IKGHQH
28 CMZGQI
29 NYAYGQ
30 IWDIGGLDGAGGIGIDKWPPD
DOI: 10.7717/peerj.7312/table-2

Note:

Numbers correspond to the motifs described in Fig. 5.

The multiple sequence alignments revealed that the conserved ACD, which comprised eight β-strands and two conserved domains (consensus region I and II) specific for sHsps, was located in the C-terminal region of the transcript of the PmsHsps (Fig. S2; Fig. 6). The “GVL” residues, which are highly conserved in consensus region I, were substituted in PmsHsp9, PmsHsp22, and PmsHsp24. In contrast, the C-terminal portions of the PmsHsps were quite variable in both sequence and length (Fig. S2).

Multiple sequence alignment of the α-crystallin domain of the sHsp proteins in P. mume.

Figure 6: Multiple sequence alignment of the α-crystallin domain of the sHsp proteins in P. mume.

The α-crystallin domain (ACD) comprises two homologous regions, consensus region II and I, separated by a linker, which is more variable in sequence and size. Potential positions of secondary structural elements (β2-β3-β4-β5-β6-β7-α1-β8-β9) are indicated above the alignment.

The distributions of the conserved motifs in the PmsHsp proteins were identified using the MEME web server, and ten distinct motifs were discovered (Fig. 7). The PmsHsps shared similar motif composition and order (Table 3). The motifs 1, 2, 3, 4, and 8 represented the ACD, which are widely distributed in the PmsHsp family. The conserved motifs 5 and 7 were distributed mainly in the N-terminal regions and motif 6 was distributed in the C-terminal regions, representing secondary structural element β10. However, the biological significance of these motifs requires further examination.

Distribution of conserved motifs in the sHsp family members in P. mume.

Figure 7: Distribution of conserved motifs in the sHsp family members in P. mume.

All motifs were identified by MEME 5.0.5 using the complete amino acid sequences. Motif sizes are indicated at the bottom of the figure. Different motifs are indicated by different colors numbered 1–10. For details of motifs refer to Table 3.
Table 3:
sHsp motif sequences identified in P. mume by MEME tools.
Motif Multilevel consensus sequence
1 QLPENAKVDZIKAAMEBGVLTVTVPKEEPKKP
2 AHVFKADLPGLKKEEVKVEVED
3 SGERNVEKEDKNDKWHRVERSSGKFLRRF
4 FSRENSAFLNTRIDWKETPE
5 FSLDLWEPFKDFPFPSSSSLS
6 VKAIEISG
7 PNFRRGSIFDP
8 GRVLQI
9 NSRJDWKET
10 ANDPFCHEVWEPFCEWKK
DOI: 10.7717/peerj.7312/table-3

Note:

Numbers correspond to the motifs described in Fig. 7.

Expression patterns of the putative PmHsf and PmsHsp genes under HS

To assess the roles of the predicted PmHsf and PmsHsp genes in the process of HS, qRT-PCR was performed to detect the transcriptional profile for 18 PmHsf and 24 PmsHsp genes in the leaves of P. mume exposed to HS. The results revealed that these genes were differentially expressed in response to HS (Figs. 8 and 9).

Relative gene expression of PmHsf genes analyzed by qRT-PCR responsed to heat stress treatment.

Figure 8: Relative gene expression of PmHsf genes analyzed by qRT-PCR responsed to heat stress treatment.

(A–R) The relative gene expression of PmHsf1-18. The vertical axis represents the fold change in expression relative to ck (onefold). The horizontal axis represents the different times of heat stress treatment. Results were normalized using PmEF1α gene expression as the reference gene. Error bars indicate standard deviation of three replicates. Different letters indicate that the means are significantly different based on Duncan’s test (p < 0.05) after one-way ANOVA.
Relative gene expression of PmsHsp genes analyzed by qRT-PCR responsed to heat stress treatment.

Figure 9: Relative gene expression of PmsHsp genes analyzed by qRT-PCR responsed to heat stress treatment.

(A–R) The relative gene expression of PmsHsp1-24. The vertical axis represents the fold change in expression relative to ck (onefold). The horizontal axis represents the different times of heat stress treatment. Results were normalized using PmEF1α gene expression as the reference gene. Error bars indicate standard deviation of three replicates. Different letters indicate that the means are significantly different based on Duncan’s test (p < 0.05) after one-way ANOVA. sHsp1* represent the total relative expression level of sHsp1, sHsp2, sHsp3, sHsp5, sHsp6, and sHsp7. sHsp4* represent the total relative expression level of sHsp4 and sHsp8.

The transcriptional levels of PmHsf3 (A8), PmHsf4 (A5), PmHsf8 (A1), PmHsf9 (A4), and PmHsf12 (A1) did not change at most of the HS time points and were down-regulated at some time points (control, 1, 2, 4, 8, and 12 h at 42 °C), whereas the expression of PmHsf18 (B3) was inhibited after HS. In contrast to those genes, the transcript abundances revealed that the remaining genes were up-regulated and their expression patterns were assigned to two categories. The expression levels of PmHsf1 (B4), PmHsf5 (A6), PmHsf7 (A4), and PmHsf17 (C1) slowly increased and reached the highest levels at 8 or 12 h of HS. The other eight genes, PmHsf6 (B2), PmHsf10 (B2), PmHsf13 (B2), PmHsf2 (A2), PmHsf11 (A7), PmHsf14 (A3), PmHsf15 (B1), and PmHsf16 (A9), exhibited enhanced expression immediately after HS, and the mRNA levels of these genes slowly or quickly decreased in the later period following HS treatment (Fig. 8).

Under HS, the expression of most of the PmsHsps increased, except for PmsHsp22. The transcripts of 13 of the up-regulated PmsHsps were present at a high abundance, that is, PmsHsp1*, 4*, 10, 11, 13, 14, 16, 17, 1821, and 23, which exhibited the highest expression at 1 h of HS, followed by a rapid or gradual fall, except for PmsHsp18; meanwhile, PmsHsp12 and 15 were expressed at moderately high levels, and the mRNA levels of PmsHsp9 and 24 were low (Fig. 9).

Discussion

Identification and conserved motif analysis of Hsf and sHsp genes from the P. mume genome

An increasing number of studies indicate that Hsf and sHsp proteins play important roles in the adaptation to environmental stress. However, no specific information is available regarding the Hsf and sHsp genes in P. mume. In this study, we conducted a comprehensive analysis of the PmHsf and PmsHsp families. Plant genomes contain numerous Hsf genes, with varying members among species (Nover et al., 2001; Baniwal et al., 2004; Lin et al., 2011; Xue et al., 2014). In four species of the Rosaceae family, Malus domestica, Fragaria vesca, Pyrus bretschneideri, and Prunus persica, 25, 17, 29, and 17 Hsfs were identified, respectively (Giorno et al., 2012; Hu et al., 2015; Qiao et al., 2015). In our study, we used AtHsf protein sequences as queries, which resulted in the identification of 18 Hsfs from the available P. mume genomic data. The numbers of Hsf genes in pear and apple were nearly two times greater than those in peach, strawberry, and Mei flower (Fig. S3), which may be the result of a WGD event in the Maloideae. A similar situation was observed in Populus trichocarpa and Zea mays (Lin et al., 2011; Zhang et al., 2015b). The 18 PmHsf genes were widely distributed on chromosomes 2–8, except for Hsf18, which was located at scaffold272. Similarly, the AtHsf genes are distributed on all five chromosomes, while chromosomes 11 and 12 of the rice genome lack OsHsf genes. The finding that Hsfs are distributed on almost every chromosome suggests that the Hsf genes may have been widely distributed in the genome of the common ancestor of both monocots and eudicots (Guo et al., 2008).

Despite considerable differences in the sizes and sequences of the PmHsfs, their basic structure is conserved. Most members of the same subclass exhibited similar motifs or domain structures compared with AtHsfs. The DBD, consisting of a three-helix bundle and a four-stranded antiparallel β-sheet, was the most conserved element of the PmHsfs. The result was consistent with the AtHsfs (Nover et al., 2001). Moreover, the DBD of PmHsfs was encoded in two parts separated by only one intron, and the position of the intron was consistent in all cases, although its size varied greatly (Fig. 2; Table S2); this is consistent with the DBD of AtHsfs (Nover et al., 2001). PmHsf2 (A2) contained two introns, which is the same condition as is found in GhHsf2 and GhHsf12 (Wang et al., 2014). The HR-A/B region is connected to the DBD by a flexible linker of variable length (15–80 amino acid residues) (Scharf, Siddique & Vierling, 2001). A similar pattern is found in P. mume. A highly conserved repressor tetrapeptide motif -LFGV- was found in class B Hsfs. Class A PmHsfs were rich in F, W, D, and L amino acid residues. Similar AHA motifs of aromatic residues in an acidic surrounding were identified in Arabidopsis (Nover et al., 2001; Scharf, Siddique & Vierling, 2001).

Small Hsp family proteins confer tolerance to environmental stresses due to their abundance and diversity. In Arabidopsis and rice, 19 and 23 sHsps have been identified, respectively (Scharf, Siddique & Vierling, 2001; Sarkar, Kim & Grover, 2009). However, little is known about this family in P. mume. In our study, 24 PmsHsp genes were identified, of which nine were detected on chromosome 1 (Fig. 1B). Moreover, two clusters of tandem-repeated sHsp genes belonging to CI were detected on chromosome 1. Each cluster included three members (PmsHsp1, PmsHsp2, and PmsHsp3; PmsHsp5, PmsHsp6, and PmsHsp7) (Fig. 1B). Similar sHsp clusters were found in rice (Guan et al., 2004; Hu, Hu & Han, 2009). The present findings may provide a basis for further study of the sHsp family and help to enable the identification of candidate genes that are useful for the breeding of ornamental plants that are responsive to abiotic stress conditions.

As in Arabidopsis, PmsHsps shared the considerably conserved ACD, but some differences existed in this domain among the PmsHsp subfamilies (Figs. 6 and 7). For instance, PmsHsp4, PmsHsp8, PmsHsp15, and PmsHsp22 lack the crucial β6 sheet, which is vital for formation and oligomerization of the dimer (Van Montfort et al., 2001).

Using phylogenetic analyses of 19 AtsHsp members and 24 PmsHsp members, eight distinct clusters, CI, CII, CIII, ER, P, M, CI(r), and P(r), comprising eight, three, one, two, two, one, six, and one PmsHsp genes, respectively, were identified and displayed (Fig. 3). The N-terminal regions of the CI PmsHsps had a WD/EPF domain. Moreover, an interesting discovery was revealed in the CII subfamily (PmsHsp11, PmsHsp12, and PmsHsp13) (Fig. S2), which had a conservative N-terminal amino acid motif (DA-AMAATP) that was not detected in the other cytoplasmic/nuclear sHsps (Waters, 1995).

Expression patterns of Hsfs and sHsps

Heat shock transcription factors are the major regulators of HSR in plants. qRT-PCR analysis revealed that PmHsf genes were differentially expressed under HS (Fig. 8). PmHsf18 (B3) was significantly inhibited under HS. PmHsf8 and PmHsf12, belonging to the HsfA1 subfamily, were not up-regulated under HS, similar to the expression of the HsfA1 genes in Arabidopsis, rice, and wheat (Hübel & Schöffl, 1994; Mittal et al., 2009; Xue et al., 2014). Among the genes with significantly increased expression, PmHsf2 (A2), PmHsf11 (A7), and PmHsf14 (A3) were early HSR genes and became predominant transcripts during HS, especially PmHsf2 (A2), which had a transcript level that was enhanced more than 500-fold 1 h after HS treatment (Fig. 8). This result was consistent with the genome-wide analyses of Hsfs in maize and cotton (Lin et al., 2011; Wang et al., 2014). Class B members of the PmHsf family (PmHsf1, PmHsf6, PmHsf10, PmHsf13, and PmHsf15) appeared to be induced by HS, with the exception of class B3 (e.g., PmHsf18), which was inhibited during HS. In class C, PmHsf17 was up-regulated and showed the highest expression level at 12 h.

In agreement with the previous findings that most of plant sHsps are highly up-regulated during HS, 23 of 24 PmsHsps exhibited variable degrees of up-regulation (Fig. 9), indicating that sHsps may play general roles in adaptation to HS. There was no single, specific expression pattern for the CI and CII subfamilies during HS; however, the ER, M, and P subfamilies shared a similar expression pattern. These same sHsp expression patterns were observed in rice under heat treatment (Sarkar, Kim & Grover, 2009).

Conclusions

This study presents a comprehensive overview of the genomic complexity and expression diversity of 18 Hsfs and 24 sHsps from P. mume. Structural characteristics and phylogenetic analyses revealed divergent expansion patterns of the Hsf and sHsp gene families in different classes and subclasses. Furthermore, qRT-PCR analysis revealed that most of the Hsf and sHsp genes were highly up-regulated in response to high temperature.

Supplemental Information

Multiple sequence alignment analysis of PmHsf proteins.

DOI: 10.7717/peerj.7312/supp-1

Multiple sequence alignment analysis of PmsHsp proteins.

DOI: 10.7717/peerj.7312/supp-2

Numbers of Hsfs in P. mume and four other Rosaceae species.

DOI: 10.7717/peerj.7312/supp-3

qRT-PCR primer sequence.

DOI: 10.7717/peerj.7312/supp-4

List of 18 PmHsf and 24 PmsHsp genes identified in Prunus mume and their sequence characteristics.

DOI: 10.7717/peerj.7312/supp-5

Amino acid sequence of 18 PmHsf and 24 PmsHsp genes.

DOI: 10.7717/peerj.7312/supp-6

Coding sequence of 18 PmHsf and 24 PmsHsp genes.

DOI: 10.7717/peerj.7312/supp-7

gDNA sequence of 18 PmHsf and 24 PmsHsp genes.

DOI: 10.7717/peerj.7312/supp-8

Relative gene expression of PmHsf and PmsHsp genes analyzed by qRT-PCR.

DOI: 10.7717/peerj.7312/supp-9
24 Citations   Views   Downloads