Review History


All reviews of published articles are made public. This includes manuscript files, peer review comments, author rebuttals and revised materials. Note: This was optional for articles submitted before 13 February 2023.

Peer reviewers are encouraged (but not required) to provide their names to the authors when submitting their peer review. If they agree to provide their name, then their personal profile page will reflect a public acknowledgment that they performed a review (even if the article is rejected). If the article is accepted, then reviewers who provided their name will be associated with the article itself.

View examples of open peer review.

Summary

  • The initial submission of this article was received on July 19th, 2021 and was peer-reviewed by 3 reviewers and the Academic Editor.
  • The Academic Editor made their initial decision on August 6th, 2021.
  • The first revision was submitted on November 2nd, 2021 and was reviewed by 2 reviewers and the Academic Editor.
  • A further revision was submitted on December 3rd, 2021 and was reviewed by the Academic Editor.
  • The article was Accepted by the Academic Editor on December 15th, 2021.

Version 0.3 (accepted)

· Dec 15, 2021 · Academic Editor

Accept

Congratulations on the acceptance of this article - thank you for carefully addressing all of the reviewers' comments.

[# PeerJ Staff Note - this decision was reviewed and approved by Valeria Souza, a PeerJ Section Editor covering this Section #]

Version 0.2

· Nov 17, 2021 · Academic Editor

Minor Revisions

The reviewers and I agree that the revised manuscript is significantly improved. However, there are some additional edits that should be made before the manuscript can be accepted. In particular, please see the comments in the annotated PDF provided by Reviewer 2.

Reviewer 1 ·

Basic reporting

no comment

Experimental design

no comment

Validity of the findings

no comment

Additional comments

I think that this paper has been refocused and greatly improved. My comments are all technical in nature.

Line 25: change to: “this gene has not previously been studied in the bacterial fraction”
Line 115: change to “up to 8 hours in cyanophage”
Line 462: change to “expected”
Line 501: I am not sure what this sentence is saying. Please rewrite. Is “this strain” HTVC008M? Perhaps: “High synteny between HTVC008M and Lake Baikal sequences was previously determined.”
Line 511: change to “expected”
Line 515: change to: low numbers
Line 516: say "more similar" rather than "more identical". However, this sentence is also hard to understand. Are you trying to say that it is hard to tell whether the viruses are more similar in the bacterial fraction compared to the viromes fraction? Since the samples >0.2 and <0.2 um are from different parts of the lake and different times. I don’t think this comparison is possible. Probably the authors can delete this sentence and just say that it isn’t possible.
Line 574: change to “expected”
Line 599: delete the words “as provided”

·

Basic reporting

The paper has been improved a lot, especially with the shift in aim and focus. The data gathered and the analyses conducted are a good foundation to discuss diversity of these phages within Lake Baikal, and their relationship to phages across the globe. However, I still think that the paper needs further attention with regards to language and structure, especially the results and discussions where different ideas are not fully explored in coherent paragraphs. It would facilitate for the reader if diversity is discussed with regards to blastp and then also linked with the clustering analysis and phylogenetic analysis. As it is now these paragraphs are not really tied into each other and sometimes they are very long and hard to follow. For the discussion, this becomes even more apparent since it is hard to follow what other phages the Lake Baikal phages are most similar to.

Experimental design

The research gap and the aim are much more suited to the data described, and the findings with regards to clusters of phages across the globe is interesting. Reporting of the findings could be improved, however, to make the data easier to follow and to understand. The methods section has also been improved and it is easier to follow what has been done.

Validity of the findings

The conclusions could still be improved to better reflect the full scope of the study.

Version 0.1 (original submission)

· Aug 6, 2021 · Academic Editor

Major Revisions

All three reviewers agreed that this research is a valuable contributionbut made numerous suggestions for improving the presentation of the information in the manuscript. When revising your manuscript, please pay particular attention to the following:

1) Add more introduction and background about Lake Bailkal - this is necessary to set the stage for the current research. It is important to explain how this study compares to prior work in the area without having to read those prior studies

2) Clearly define the goals of the study and make sure that the stated goals align with the focus of the paper. Two reviewers noted that there is not much information on the comparison between size fractions and therefore this shouldn't be the main goal of the paper. In reorganizing and streamlining the manuscript, be sure to clearly express the study goals, how the work fills a knowledge gap, and the conclusions and impact. This will improve the readability of the manuscript.

3) Please elaborate on the methods, especially regarding bioinformatic processes and statistics, to the point where the study could be reproduced by a reader.

4) Reviewer 1 provided additional sequences to include in your analysis

[# PeerJ Staff Note: Please ensure that all review and editorial comments are addressed in a response letter and any edits or clarifications mentioned in the letter are also inserted into the revised manuscript where appropriate.  It is a common mistake to address reviewer questions in the response letter but not in the revised manuscript. If a reviewer raised a question then your readers will probably have the same question so you should ensure that the manuscript can stand alone without the response letter.  Directions on how to prepare a response letter can be found at: https://peerj.com/benefits/academic-rebuttal-letters/ #]

Reviewer 1 ·

Basic reporting

In “Communities of T4-like bacteriophages associated with bacteria in Lake Baikal: diversity and biogeography” Potapov et al sequenced the gp43 gene, representing myophage, across many geographical regimes in Lake Baikal. The authors then compare to gp43 sequences in other environments, finding that Lake Baikal had potentially endemic viruses.

It would be helpful if the authors include a section about Lake Baikal in the introduction. Where and what is Lake Baikal and why is it interesting? Tell us about it. Have viruses previously been examined in Lake Baikal? Highlight the variety of regimes in Lake Baikal. Write this for people who have very little knowledge of Lake Baikal.
The authors need to better explain the goal of their work in the introduction. I think that understanding viruses in Lake Baikal and comparing to other lakes should be the main goal and comparing size fractions is a sub-goal—especially as the authors don’t have a direct comparison. Comparing fractions isn’t actually the most interesting part of this paper. I think the description of Lake Baikal will help the authors express their goals better.
The authors already have two papers describing the gp43 gene in Lake Baikal. They need to make very clear to the reader what is new in this publication. Yes, the bigger size fraction is new. But the wider geographical sampling is also new. So is comparing across regimes in the lake and then between lakes. I think these Lake Baikal focused questions is probably where the biggest focus on the paper should be.

Please note that gp43 is actually DNA polymerase B.

Detailed comments:
Line 25: “formed a Baikal cluster”
Line 27: “most OTUs had cultivated closest relatives”
Line 36: delete dash
Line 40: “belong to the order”
Line 48: How about citing something about myo-pelagiphage here. (Zhao et al., 2013; Zaragoza-Solas et al., 2020)
Lines 52-59: This section is very long and technical and never comes up again in the discussion. I think it could be deleted or greatly shortened.
Lines 60-61: This sentence is very vague. Be more specific. Viral lysis creates dissolved organic matter that is eaten by other bacteria instead of having cells eaten and their carbon moving up the food chain.
The authors could also mention virally mediated horizontal gene transfer as a reason why viruses are important.
Line 87-88: This sentence is technically true, but quite misleading. Cyanophage can have latent periods up to 8 hours. See table in (Mruwat et al., 2021) for a collection of cyanophage latent periods. Or (Zhao et al., 2013) for a myo-pelagiphage latent period. 20 minutes is much much too fast for environmental phage.
Additionally, the authors can look in (Langenfeld et al., 2021) for issues with typical methods to obtain viromes.

References
Langenfeld, K., Chin, K., Wigginton, K.R., and Duhaime, M.B. (2021) Comparison of ultrafiltration and iron chloride flocculation in the preparation of aquatic viromes from contrasting sample types. PeerJ 9: e11111.
Mruwat, N., Carlson, M.C.G., Goldin, S., Ribalet, F., Kirzner, S., Hulata, Y., et al. (2021) A single-cell polony method reveals low levels of infected Prochlorococcus in oligotrophic waters despite high cyanophage abundances. ISME J 15: 41–54.
Zaragoza-Solas, A., Rodriguez-Valera, F., and López-Pérez, M. (2020) Metagenome Mining Reveals Hidden Genomic Diversity of Pelagimyophages in Aquatic Environments. mSystems 5: e00905-19.
Zhao, Y., Temperton, B., Thrash, J.C., Schwalbach, M.S., Vergin, K.L., Landry, Z.C., et al. (2013) Abundant SAR11 viruses in the ocean. Nature 494: 357–360.
Nishimura, Y., Watai, H., Honda, T., Mihara, T., Omae, K., Roux, S., et al. (2017) Environmental Viral Genomes Shed New Light on Virus-Host Interactions in the Ocean. mSphere 2: e00359-16.
Luo, E., Eppley, J.M., Romano, A.E., Mende, D.R., and DeLong, E.F. (2020) Double-stranded DNA virioplankton dynamics and reproductive strategies in the oligotrophic open ocean water column. ISME J 14: 1304–1315.

Experimental design

The authors need to more clearly express how this research fills identified knowledge gaps.

I think the authors should add myo-pelagiphage sequences from (Zaragoza-Solas et al., 2020) and (Luo et al 2020) to their database. There is now a much larger diversity of pelagiphage known. This addition is likely to increase the viral OTUs identified as pelagiphage. These sequences could also be added to the phylogenetic tree.

In fact there are quite a few complete genome Metagenome Assembled Viruses that could be examined for gp43 and added to the tree. In (Nishimura et al., 2017) they assembled many marine viruses, but also have a table that links some viruses to hosts. The authors don’t have gp43 data from the oligotrophic ocean. These Metagenome Assembled Viruses could help fill that gap. (Install blast on your computer, and blast the assemblies with gp43 to find the appropriate sequences)
Adding in the viruses from (Zaragoza-Solas et al., 2020) is more critical. But adding from Nishimura et al., 2017 could be interesting.

Validity of the findings

Validity of Findings
I think the conclusions of this work could be greatly strengthened.
If the authors can express their goals in the introduction, then indicate how their work filled knowledge gap in the discussion, it will make it easier for them to more strongly state their conclusions.
Make sure to point out the bigger consequences of this work.
What is unique about Lake Baikal that would promote endemic viruses? What other places in the world would you imagine could have similar viruses to Lake Baikal? In other words, where would you sample next to see if the Lake Baikal viruses are actually endemic?

Additional comments

I already have the myo-pelagiphage sequences that I want the authors to add to their database and tree. Here they are. The HOT sequences are from Luo et al 2020 and the PMP sequences are from Zaragoza-Solas et al., 2020.

>Pelagiphage_HOT_VTLG01007445-FGLCGAHL_01252_DNA-directed_DNA_polymerase
MSTFYTNVLQWGNYILLREVVDGERKNTRIKYSPTLFAPVEKPTKFKTLQGGYATPIKFDSIKEAKEWIQMNSSQPDLVY
GNTQYSYCYLSDRYRGLIDWNMDEMLIVTLDIEVQCENGFPHVKQAEEEMLSISIKNHQSKKIIVWGIGEFKTDRDDVTY
IQCESEVHLLKEFLVFWEKYQPDVITGWNTEFFDIPYLCNRIKKVLSEDDLIRLSPWKSVRPRDVYQMGRTHQVYEIQGV
AALDYFELYRKFTYTNQESYRLDHIAFVELGERKDGNPFDTFREWYSNDYQSFIEYNINDVELVDKLEDKMKLIELCLTM
AYDAKVNLTDVLGTVRYWDILIYNYLREKHIVIPQKKEAQKFEKYEGAYVKDPQVGMHKWVMSFDLNSLYPHLIMQYNIS
PETLLPTVNEKVTVDKIIEGKVKNTSDYCLTPNGAFFRKDKRGFLPELMENIYEDRVKFKKLMLDAQQSYENTKDKKLLS
TISRYNNIQMAKKISLNSAYGAIGNNWFRYFDLRNAEAITTSGQLSIRWIEKALNIYLNKILETEGKDYVIASDTDSVYI
TFDELVSKVYPEGARAEKIVTFLDRVAKEKLEPFIDESYKALAKVTNAYEQKMVMGREVIADKAIWTAKKRYILNVHDSE
GVRYKEPKLKMMGIEAVKSSTPAPCRQKIKECLSIIMSGNEKELNTFIQDFREEFMKLSPEEIAYPRSCNGLLKWTADHN
LFKKGAPIHVKGAILYNYLLDKHKLENKLPKIMNGDKIKFINLRTPNLYQSTAFSFITEFPKELDIIQLIDYDTQFEGAF
ISPLKFITDKIRWKIDGSYGDQMNLEDFFA
>Pelagiphage_PMP-MAVG-18-KCKFIKKH_02145_DNA-directed_DNA_polymerase
MNLASSFYTNVVEHKGKLLIRGVNNGQSYLSRINYSPTLYLPTKEESKYKTLDGTNLKAKRFDSISKAKHFYSEYAPIPE
YKIFGMNRYNYQYIADEYKGEMKWNKDYIKIFTLDIETECEGGFPDPDTAKETIICITIKNHSNKQIITWGTGDFISKKT
NVTYVKCQNKKHMLLEFLKFWCKNHPDILTGWNVKFFDMPYLMNRMRYIFDNDTINKMSPWNYVNADRIQLGNKSNQIWN
ILGVSVLDYFDLYKKFTYVRQESYKLNYIAKVELGEQKLDNPYETFKDFYTKDYQRFVEYNIQDVELVDRLEDKMKLIEL
CLTMAYDYKVNYTDVYSQVRCWDTIIYNHLLTKNIQIPPREDQIKDTQYEGAYVKDPQLGLHNWIVSFDLNSLYPHLIMQ
YNISPEMFVGTEPKAVGVENFLDERLNLKWAKDRNVTIAPNGAMFKRDKQGFLPELMEKMYTERVVYKKKAIEAKKEYQK
TKDPIYSNEISRCHNIQMAKKISLNSAYGAIGNQYFRYFDVKQAEAITLGGQLSIRWIERDVNKFMNKLLGTDNKNYVVA
SDTDSIYLKLDTLVEKVCKGKSTKQIVDFLDKAAEEKIQKVIDSSFENLAKYVNAYQQKMIMKREAIANKGIWVAKKRYM
MNVFDEEGVKYDIPKLKIMGVEAVKSSTPEVCRGKIKDAIRVIMNDSEDALIKFVNDFKEVFMTLSPEEVAFPRSCNNLN
KYIDSNSIYKKGTPIHVKGALIYNHNISKHKLGMKYPYIQDGDKIKFLMLKQPNTVKDTVISFSTKIPYEFELHKYVDYD
TQFQKTFTDPLRFILDSIGWKLEREATLESFFE
>Pelagiphage_PMP-MAVG-24-KCKFIKKH_03891_DNA-directed_DNA_polymerase
MNFYTNVGRYGNMLLYRGIENGNRVSRKVKYKPTLYVATSKPTDWKALDGTPVAPVTQFESMRDAKDWISLNKEVSGRKI
YGNNRYISTFINEKFPGDIEFDRNAINVTTIDIEVASDDGFPEPDVASKEVTAICIKNNIDNTYYVWALRDYDVNQSIMQ
TNRVVYKKCDTEGQLLLDFITHWSSPTHCPDVVTGWNSRFFDIPYLVNRINNLLGSDWVKKLSPWGLIDSRDVTIMARKQ
TAYEIAGISQLDYMELFKKFGYSYGAQESYSLNHISHVVLGEKKLSYEEHSSLFSLYLNDHQKFIDYNIKDVELVDRIED
KLGLITLALTMAYRGGVNYGDTFGTTAIWDSIIYRDLSTQKIAVPFQEDKVKTPYPGGYVKDPQVGINDWVVSFDLNSLY
PSLIMQYNMSPETIASGELSDYDVDSILKNHTIVDNRGKAVSANGQYFNIDKKGILPKIIEQMYGERVQIKKAMIKAQKE
LQKVDKNDKQEVYRIERDIAINENRQMSIKILLNSLYGALGNKYFRFFDQRIAEGITLSGQLTIRWAEEAINTYLNKVLK
TNKDYVLAIDTDSVYVCLNDLVKAVNPSNPIDFLDTVCREKLEPVLEEAYKKLYSIMGGIENKMVMGREVIADRGLWTAK
KRYILNVHDNEGVRYAEPKLKIMGIEAIKSSTPAPCREALKEIFKVIMHSSESDVQKSIEHFRQYFRTLEPNDIAFPRGI
TNLTSFQDRNTIYRKGTPIHARGGILYNKLIDDLSLGKRYNKINNGEKIKFIYLRTPNPIKENVISFLDYLPTEFGLNKY
IDHETQFQKTFLDPIEPILDAIGWSSKEVSTLDEFFG
>Pelagiphage_PMP-MAVG-13-KCKFIKKH_02947_DNA-directed_DNA_polymerase
MDFYTNVCRSRDKILVQGYQGNIKKKIAVAYRPKHFILSKRGQTPYKSLDGRPLEVVELNSMGGARKFREKYEGVEGFEI
HGYDRYVYTYISDKFQGDIQWDFNKVKIATLDIECECEDGFPEPMLASEKVNAITIKPFRKEPQVFGIGEWNHNQNLTYH
NCKNEFDLLQKFIKYWRTEWFDIVTGWNVNSFDITYLCNRIDRLMGEDEHKKLSPWGQSNVREFTTMGYQKQQVFDLLGV
NIIDYLEMYRKKTFINQESYKLDHIAHVELGKGKLDYSEYGSLHTLYKQDYAKFLEYNVRDVVLVEELDNKLGFMELVMS
QAYTAKCNYSDTFGMVKYWETIIYNFLKEQGIQTPPQRLKTGNDKNKPIVGAYVKEPLVGGHNWVMSFDLNSLYPHIIMQ
YNISPEKLVKGNRQDVNIDRLLDKKCDLSYCKQTNTAVAPNGVLFSREKQGMFPELMETFYEERKEWKKKMLEYQSERQT
TQDVKRKRELDTLIKRAYNNQQVRKIALNSAYGAMANQYFAFFSIDLAEAITMSGQLIIKWAEKTANTYLNELLKTENED
YVIAMDTDSIYLSMDKFVQKVFPEDTPKTKIIDFLSKAESKIEEALADGFKDLAEYTNAFQQKMEMGREVIADRGIWTAK
KRYILNVHDNEGVRLREPKLKMMGIETAKSSTPQWVRNKLEEALNVVMNKSEQDLWEFVETTRKEFRTLTPEEVAFPRGC
KGLIQYQDSTNIYAKGTPIHVRGSLLYNNLLNKRNLDMRYETIKNGEKVHFTYLTLPNPINENVISFTTSLPREFDLHRF
IDYDMQFDKSFVEPLKNIVQLINWNVEPVASLDSFFG
>Pelagiphage_PMP-MAVG-14-KCKFIKKH_01192_DNA-directed_DNA_polymerase
MRFYTNISQWGNNLLLREVIDGKRVNRKVKYSPTLYCPVMRETNFKTLEGKYVTPIKHQTMRDAKEWVEQYKEQPHLLYG
NTQYQYSFLYENYPNLEWSLDDVLIATIDIEVACENGFPNPQDAIEPLLSITVKNHANKQIFVWGVGMYKTTRPDVAYVN
CENEKELIYEFLKFWQMNQPDVITGWNTEFFDIPYLCNRIKKLCGEDDLKKLSPWKSVSSKNIYSMGRSHQVWDIQGIAA
LDYYDLYRKFTYTNQESYRLDHIAYVELGERKDGNPYDTFKDWYTNDFQSFIDYNITDVEIVDKLEEKMKLIDLCLTMAY
EAKVNYTDVLGSVKYWDILIHNYLMDKGIVVPQKVEREKSEKYEGAYVKDPQTGMHEWVLSFDLNSLYPHLIMQYNISPE
TMKSEQTVPNMSVDKLLDKQIDTSILKNTTMTPNGALFRTDKKGFLPEMMQKMYDDRVRYKKAMLEAKQNLVNTKDKKYE
KQISTFNNIQMAKKIALNSAYGAIGNNWFRYYSHTMAEAITTSGQLSIRWIEKKINSYMNGLLKTKDKDYVIASDTDSVY
ITFDELIKKLNPKYPIDFLDTIAKEKVEPFIDQSYQELANYLHAYEQKMQMKREVIADKGIWTAKKRYILNAYDIEGVRY
KEPTLKIMGIEAVKSSTPAPCREKIKEALKIMMSGDEKELNKFIQNFREEFLTLPPEDIAYPRSVNGLNKWSETHTLFKK
GAPIHVKGGILYNHLVKKNKLTRYYPLIQEGDKIKFLYLKLPNIYQSSSISFITTLPKQLDFKVDYELQFEKSFIEPLNF
IIEKIGWFVDRTYGTQGTLEDFFA
>Pelagiphage_HOT_VTLG01009199-FGLCGAHL_01490_DNA-directed_DNA_polymerase
MYSFYKDVIEYKGNLLVRGIHEGEEFKEKVNFRPTLYAITQNKTNHKTLQGQYLKPITFDSIYKCRDFKRNYTNSSAPLY
GNDRYHFQYIAKNYPSDVQFDKNLIKIFTLDIEVTAEKGFPDVENPIEEILCLTIKNQSNKNIITWGTKPFFTKRPDVTY
IECQSEKQLLMEFFKFWTKNYPDIITGWNTKFFDLPYLCNRIKYLVGDKVINKLSPWGLIEQEQITVRGRSQTAYDIKGI
TMLDYLDLYKKFIPVRQESYKLDYIAKVELGSDGKDSNPYDTFREWYTNDFQSFVDYNIKDVELVDQLEDKLRLIELILT
MAYEAKINYQDVFSEVRLWDTLIYNHLLKENIHLPPRGDNVKEEKYTGAYVKTPQVGQHKWIVSFDINSLYPHLIMQYNI
SPEKMIGVKPQGISVNKMLQQKTPLDYLETEGCTITPNGAMFKTDSQGFLPKLMEKMYNDRVHFKKLEFEAKKEYQKTKD
PMYEKEISRCHNIQWAKKISLNSAYGAIGNQYFRFYNVHQATAITTAGQFIIQYIEQQVNKYMNDILQTKDKVDYIVASD
TDSIYLCLDKLVEKVCKDKTKEQKINFINKVVENKLEPFIDKCFIQLAKYTNAFQQKMVMKRECIADKGIWTAKKRYMLN
VLDEEGFRFEEPKLKIMGIEAVKSSTPEVCRVAIKEAIKIVMNKEETDLHNYIAKFREEYKQYEPEQIAFPRSCNNLRKY
FSPSDIFIKGTPIHIKGSLIYNYHLKNQNLDYKYPLIQEGDKIKFILLKEPNPFKFNVCSYISTLPREFKLKDYVNYDLQ
FEKTFLDPMRFILGAINWSAEPKASLESFFV
>Pelagiphage_HOT_VTLG01003937-FGLCGAHL_00752_DNA-directed_DNA_polymerase
MEFMKFWMKNYPDVITGWNTKFFDLPYLCNRIKLLTDEKVIRKLSPWNIVEQETVEVRGRPQTVYNVVGIAMLDYLDLYT
KYIPTRQESYRLDWIGQVELGEKKDDNPYDTFKEWYTKDLQSFIDYNIQDVEIVDRLEDKLGLIELVLTMAYDAKVNYSD
VFSQVRTWDTLIYNHLLKNKIAVPPREEHSKDTKYIGAYVKDPQVGMHKWVVSFDLNSLYPHLIMQYNISPEKIIGMKGN
GVSVSNLLNKKSDLSYLKKEGACITPNGALFKTDSQGFLANMMETMYKERVKFKQKEIKARQEYEKTKEKSLLKKVSRFH
NIQWSRKIALNSAYGAIGNQFFRYYDVRQATAITTGGQYVIKFIENKMNDYLNHLLKTDDHDYIVASDTDSIYVCLDKLV
EKICGNKSKDQVVEFLNKACEKQFEPYIDKCYKELAEYTNAFDQKMEMAREVIADKGIWVSKKRYMLNVYDSEGVRYAEP
KMKIMGIEAVKSSTPAICRKRIKEAIDIIMKKEEPDLINFVDKFKNEFEGLPPEAIAFPRSCNNLKKYSDASNIFQKSCP
IHVKGSLIYNHYLKQLKLTAKYPLIQEGDKIKFILLKEPNPFKYGVISYLTKLPREFKLQEYIDYTTQFEKTFLDPLRFI
LNSIGWKYERVASLEDFWN
>Pelagiphage_MAVG-MED-4-KCKFIKKH_00402_DNA-directed_DNA_polymerase
MDFYTNVCRSRDKILVQGYQGNIKKKIAVAYRPKHFILSKRGQTPYKSLDGRPLEVVELNSMGGARKFREKYEGVEGFEI
HGYDRYVYTYISDKFQGDIQWDFNKVKIATLDIECECEDGFPEPMLASEKVNAITIKPFRKEPQVFGIGEWNHNQNLTYH
NCKNEFDLLQKFIKYWRTEWFDIVTGWNVNSFDITYLCNRIDRLMGEDEHKKLSPWGQSNVREFTTMGYQKQQVFDLLGV
NIIDYLEMYRKKTFINQESYKLDHIAHVELGKGKLDYSEYGSLHTLYKQDYAKFLEYNVRDVVLVEELDNKLGFMELVMS
QAYTAKCNYSDTFGMVKYWETIIYNFLKEQGIQTPPQRLKTGNDKNKPIVGAYVKEPLVGGHNWVMSFDLNSLYPHIIMQ
YNISPEKLVKGNRQDVNIDRLLDKKCDLSYCKQTNTAVAPNGVLFSREKQGMFPELMETFYEERKEWKKKMLEYQSERQT
TQDVKRKRELDTLIKRAYNNQQVRKIALNSAYGAMANQYFAFFSIDLAEAITMSGQLIIKWAEKTANTYLNELLKTENED
YVIAMDTDSIYLSMDKFVQKVFPEDTPKTKIIDFLSKAESKIEEALADGFKDLAEYTNAFQQKMEMGREVIADRGIWTAK
KRYILNVHDNEGVRLREPKLKMMGIETAKSSTPQWVRNKLEEALNVVMNKSEQDLWEFVETTRKEFRTLTPEEVAFPRGC
KGLIQYQDSTNIYAKGTPIHVRGSLLYNNLLNKRNLDMRYETIKNGEKVHFTYLTLPNPINENVISFTTSLPREFDLHRF
IDYDMQFDKSFVEPLKNIVQLINWNVEPVASLDSFFG
>Pelagiphage_PMP-MAVG-16-KCKFIKKH_03510_DNA-directed_DNA_polymerase
MKFYTNVSQWGNNLLLREVVDGQRINRKVKYTPTLYSPVMRETKFKTLDGKYVTPIKHLSIKDSKEWVEQYKQQPHLIYG
NTQYQYSFLYENYRNLEWSLDDILIATIDIEVKCDNGFPNPQDANDELLSITIKNHANKQIFVWGVGEYKSTRPDVAYVK
CETEKELIFEFLKFWQHNQPDIITGWNTEFFDIPYLCNRINKLFDEQQLKRLSPWGSVQARTIYKMGRNHQVFDIQGIAA
LDYYDLYRKFTYTNQESYRLDHIANVELGENKDGNPYETFSEWYQKDFQSFIDYNIMDVEIVDKLEDKMKLIELCLTMAY
DAKVNYTDVLGSVKYWDILIHNYLMDRNIVIPQKTYSEKSDKYEGAYVKDPQTGMHKWVLSFDLNSLYPHLIMQYNISPE
TMKSEKTVPNMTVDKLLDKKIDTSILKNTTMTPNGALFRTDKKGFLPEMMQTMYDDRVKYKKYMLEAKQNLVNTKDKKYE
KQISTFNNIQMAKKISLNSAYGAIGNNWFRYYSNTMAEAITTSGQLSIRWIEKKINEYMNSILKTEKVDYVLASDTDSVY
ITFDTLIEKVKPKNPVDFLNTIAKEKIEPFIDKSYQELADYLHAYENKMQMKREVIADKGIWTAKKRYILNAWDVEGVRY
KEPTLKIMGIEAVKSSTPAPCRAKIKEALKIMMSGDEKELNTFIQDFRKKFLTLAPEEIAYPRSVNGIGKWSETHTLFKK
GAPIHVKGGILYNHLIKKNNLGNIFPYINEGDKIKFLYLKLPNIYQSSAISFITKLPKQLDFKVDYELQFEKSFIEPLNF
IIEKIHWNVDRTYGTSGSLEDFFS
>Pelagiphage_HOT_VTLG01014405-FGLCGAHL_03109_DNA-directed_DNA_polymerase
MNFYKNVIEHKGKLLIRGVLNGKDYKDKIDFGPTLYALSQQKSEIKNLQGQYLKPITFNDIKSARQFKKDYGAQSPLFGL
ERYHYQYIGKNYPDAIEWSKDHIKIFTLDIETACENGFPDVENPIEELLCITVKNQSNKQIITWGVGDYHTDRPDVTYVK
CRDEKQLLFEFMKFWLKNYPDIITGWNTKFFDLPYLMNRIKLMAGDKVANRMSPWNLINRDEIVVRGRPQTVYQLFGIVM
LDYLDLYKWFIPTRQESYRLDFIGELELGQKKHENPFETFKDFYTKDFQKFVDYNIQDVEIVDALEDKLGLIDLSLTVAY
ESKVNYDDIFSQVRVWDTLIANHLMKKNIAVPPREEHSKETKYEGAYVKEPQLGGHNWIVSFDINSLYPHIIIQYNISPE
KIIGSSSKGVSVNKMLNRTPLDFLKTEGACLTPNGAMFKNDSQGFLPEMMETMYNERVVYKKRMLKAKQQYQRTKSPELV
KEISRCHNIQWARKIALNSAYGAVGNQYFRYYDVRQASGITTAGQFIIRFIEDKMNEYLNKVLQTQGKKDYIVASDTDSI
YVCLDKLVEQTCKDKSDDEIADFIGKVCDKKLEPYIEKCFAELADYSNAFKNAMVMKREVIANKGIWVAKKRYMLNVLDE
EGIRLSKPKLKLMGIEAVKSSTPQVCRGKIKDAIKIIMSKKESDLHDFVAEFKKEFKALPPEAIAFPRSCNNLRKYRDNS
NIFIKGTPIHVKGALIYNYQVKEFGLQNKFPYIQEGDKIKFIKLVEANPFKFDVISYITSLPKEFKLQQYVDYETQFEKT
FLDPMRFILQAIGWEHEPKATLEAFFG
>Pelagiphage_PMP-MAVG-20-KCKFIKKH_04015_DNA-directed_DNA_polymerase
MNSKIGTNFYTNVSTTANDVLVRAVTDVGTRIQERIPFKPHCYITKGTGDTPYKTLDGKPCYRVNFDSMKHARTFFEEFK
TISNFDVHGMLSFTHQYINQAYPEASLDFDYYKIRIYSLDIETTTENGFPDVNNPTESIILLSVQDIHTKKIITWGLKKY
TGERTDVEYRAFPDENAMLDDFIKWWHKNCPDIITGWNVGAFDTVYLYKRIQILLGDYTAKKLSPWSFISSKTVSVRNRQ
TTYIDFEGTSLLDYMSLYKKYTYTNKESYKLVDIAQDELGVTKLDHSEYASFKEFYTKNWNKFVDYNIRDTELITQLEDK
MRLLELIVTFAYKAKVNFTDVYSQVRTWDMIIHNHLIQKNIIIPPKKPIGKSQQFEGAYVKDPILGMHKWVVGFDLTSLY
PHLIMHYNISPETIQNKTYKSGVDHYLNNPAEFQDDETVAVNGSVYTNKIEGMLPNIMNTFYAQRDIAKKKLIEAEKQFQ
TTKDPKLKKVISKYNNEQMAYKIALNSAYGAIGNEHFRYFDIRMAEAITLGGQLAIKWIHNKMNDYVNKILKTENKDYII
AVDTDSIYVNFEKIVEKAFLDVPDRPKIVAFIDKICQDKIIPYINTCYDELAKRHNAKNKMIMKRESISDRAIWTAKKRY
ILSVLDQEGISYSTPKFKIMGLEIVKSSTPMIVRKKLKDALPIILYGNQYELFNFINNYKKEFYNLRPEQIAFPRSCQGI
NEYADSVKIYKLSTPMHTRGALMHNHFVNKMKLAKKIALIRESDKIKFIHLKTPNPLQSTNVIAFLDTLPSEFKVDQYID
YDTMFQKVFLDALKLMTTPLGWKTEETSSLEDFF
>Pelagiphage_PMP-MAVG-1-KCKFIKKH_05279_DNA-directed_DNA_polymerase
MDFYTNVSRFGNNLLYIGYKGGQRIQKRIPFKPTLYVSTPEPKSGWRTLFDEPVDPIEFDSMRDAKDFEKRYQGVDTFNI
YGMNDFVAQFIAQKYPEEIKFNRDDVSVTSFDIEVQSDEGFPEPKYANYPITAITTKNNKENVYRTWGCGDYNPAENVLY
TKCQNEAALLHKFLDYWKQNYPDIVTGWNSISFDMVYVINRLRKIYGEDKVKELSPWGHVNEDKGTDYYGKEAITYEILG
VTQLDYKEIFRKFTYNTLGEQESYTLNNIAHVVLGEGKISYEEQDSLFALYKNDFQKFIEYNIKDVELIDRFEESLGLIT
LTLTMAYRGGVNYRDALGTTKIWDNIIYRMLNKNKVVCPPKEEKSKSSFVGGYVKEPQVGSHEWVVSFDLNSLYPNIIVQ
NNMSPETVVDGLVNTSLEHMLRKQTEIDTAYATAPNGARFKKNRQGVIPFVIQNYYEERVDIKKEMLELKQEYESTPTKS
LSNKISHLDNQQMSIKILMNSLYGALGNRWFRYFDQRVAESVTLGGQLSILWAERTVNKEMNKLLETDDKDYVIAIDTDS
LYINMGELVQKFNPKNPVKFLDEISKTHFEKVLTKSYQELAEYSGAMTNRMEMGREVIADKGIWVAKKRYILNVHNSEGV
QYKEPKLKIMGIEAIKSSTPELVRDNMKKLFKIIVAQTQDDAQHFVSVFKNVFKDSPAEDISFPRGVRHVKKYADRNTIY
GKGTPIHSRGCLLYNHYLRQNNLTIKYEEINNGEKIKYTYLKTPNPINENVISFKNVLPKELNLNKYIDYEKMFEKTFLE
PLEPIFDAVGWSAEPRASLEDFFS
>Pelagiphage_PMP-MAVG-2-KCKFIKKH_04412_DNA-directed_DNA_polymerase
MSRFYTNIIQWGNNLLLREIVNGERINRRVKYSPTMFCPVMRETKYKTLQGKYVMPVKHETIKEAKNWVQQYEDQPHLVY
GNTNFQFSYLYEQYPNLEWNMDEVLIITIDIEVACENGFPNPQEASEELLSITIKNQQNKQIFVWGVGKFKTERKDVVYI
ECDNEYELLTEFIKFWKLNQPDVITGWNTEFFDIPYLCNRIKKIMNEDTLKDLSPWRSVLSKTIYQMGRQYQVYDIQGVA
ALDYYDLYRKFTYTNQESYKLDHIANVELGIKKDENPHDTFRDWYTNDFQSFIDYNIKDVEIVDQLEDKMKLIELCLTMA
YEAKVNYVDVLGSVRYWDVLIHNYLMDKKIVIPQKTNKEKSDKYEGAYVKDPQVGEHKWVVSFDLNSLYPHLIMQYNISP
ETLKSDKTIPNMNVDKLLSKKVDTSILKDTTMTPNGALFRTDKKGFLPEMMQTMYEDRVKYKRAMLDAKQEYEKTKNPKL
LKMISKFDNIQMARKISLNSAYGAIGNNWFRYYNLPIAEAITTSGQLSIRWIEEKLNEYMNELLKTKDVDYVIASDTDSV
YIRFDELVEKFKPKNPVDFLDTIAKEKVEPFINKVYKELADYTKAFEQKMQMKREVIADKGIWTAKKRYILNAHDVEGVR
YKEPKLKIMGIEAVKSSTPAPCRENIKQALRIIMDGDEKELNTFIQNFRKKFLTLAPEDVAYPRGVNGLSKWTESHNLFK
KGAPIHVKGAILYNHLIKKNKLGYKYPLIQEGDKIKFLHMKLPNIYQSSSISFITKLPKEISFAVDYDLQFEKSFIEPLN
YIIEKIKWNVDRSYGTQGTLESFFA
>Pelagiphage_PMP-MAVG-25-KCKFIKKH_01574_DNA-directed_DNA_polymerase
MTNFYKSVIEHKGKLLVRGIHDGKDYKEKIDFGPTLYSITQKDTKFKTLDNRNLNPIKFKNINDARRFRRDVATDNSPIY
GLERFHYQYINDQFPKNIKWEKKFIKIFTMDIETTVTDGFPDVENPTEEIICITVKNQTNKQIITWGTGAYKTDRLDVTY
VQCKTEQHLIMEFMKFWLKNHPDVITGWNTKFFDLPYLMNRIKLIAGEKVATRMSPWNLIEKNEIIVRGRPQTTYTLKGI
VMLDYLDLYRWFIPTRQESYKLDFIGELELGKKKHVNPFETFKDFYEKDFQKFIDYNIQDVEIVDAMEDKLGLIELALTV
AYESKVNYDDIFSQVRVWDTLIANHLLAKNICIPPREEHIKDTKYEGAYVKDPKVGQHKWVVSFDINSLYPHIIIQYNIS
PEKIIGQDPSGISVNKMLKRKIDLSYLKNENACVTPNGAKFKNDSQGFLPEMMETMYNERVVYKKRMLTAKKLYQKNKDP
ELLKEISRCHNIQWARKIALNSAYGAVGNQYFRFYDVRQASAITTTGQFIIRYIEEKVNDYMNKILKTEFDYIVASDTDS
IYVTMDKLVEKTCPGKTNEQICNFIDKVVDSRIEPYIKKCFNELSEYSNAFKNCMVMKREIIANKGIWVAKKRYMLNVLD
DEGVRLADPKLKIMGIEAVKSSTPQVCRGKIKEAIQIIMNKDELTLQKFIADFKKEFLEMVPEQISFPRSCNNISKYRNP
ATIFSKGTPIHVKGSLIYNHKLKEMKLHKKYPYIKEGDKIKFLKLIQANPFRFDVISYITTLPYEFNLKKYIDYETQFEK
TFLDPMRFILQSIGWSQEKKANLEAFFG
>Pelagiphage_PMP-MAVG-15-KCKFIKKH_04586_DNA-directed_DNA_polymerase
MNSKIGTNFYTNVSTTANDVLVRAVTDVGTRIQERIPFKPHCYITKGTGDTPYKTLDGKPCYRVNFDSMKHARTFFEEFK
TISNFDVHGMLSFTHQYINQAYPEASLDFDYYKIRIYSLDIETTTENGFPDVNNPTESIILLSVQDIHTKKIITWGLKKY
TGERTDVEYRAFPDENAMLDDFIKWWHKNCPDIITGWNVGAFDTVYLYKRIQILLGDYTAKKLSPWSFISSKTVSVRNRQ
TTYIDFEGTSLLDYMSLYKKYTYTNKESYKLVDIAQDELGVTKLDHSEYASFKEFYTKNWNKFVDYNIRDTELITQLEDK
MRLLELIVTFAYKAKVNFTDVYSQVRTWDMIIHNHLIQKNIIIPPKKPIGKSQQFEGAYVKDPILGMHKWVVGFDLTSLY
PHLIMHYNISPETIQNKTYKSGVDHYLNNPAEFQDDETVAVNGSVYTNKIEGMLPNIMNTFYAQRDIAKKKLIEAEKQFQ
TTKDPKLKKVISKYNNEQMAYKIALNSAYGAIGNEHFRYFDIRMAEAITLGGQLAIKWIHNKMNDYVNKILKTENKDYII
AVDTDSIYVNFEKIVEKAFLDVPDRAKIVAFIDKICQDKIIPYINTCYDELAKRHNAKNKMIMKRESISDRAIWTAKKRY
ILSVLDQEGISYSTPKFKIMGLEIVKSSTPMIVRKKLKDALPIILYGNQYELFNFINNYKKEFYSLRPEQIAFPRSCQGI
NEYADSVKIYKLSTPMHTRGALMHNHFVNKMKLAKKIALIRESDKIKFIHLKTPNPLQSTNVIAFLDTLPSEFKVDQYID
YDTMFQKVFLDALKLIITPLGWKTEETSSLENFF
>Pelagiphage_PMP-MAVG-23-KCKFIKKH_05126_DNA-directed_DNA_polymerase
MDFYTNVARTRDKILVTGYQGNKKQKLQVSYRPKHFIPSKKGETPYKSLDGRYLEVVELNSMGGARKFREKYDGVEGFEI
HGYDKYLYTYISDRFQGDVDWDFNKIRIATLDIECECENGFPEPMLASEKVNAISIKPFKKETVVFGIGPWEHNKTDVIY
VDCTNEFDLLTKFIKYWRTSNFDVITGWNVNSFDITYLCNRIDRIIGEGEHKKLSPWNQTNVREFTTMGYQKQQVYDLVG
INVLDYLEIYRKKTFVNQESYRLEHIAQVELGKGKLDYSEYGSLHTLYKQDYAKFLEYNVRDVVLVEELDDKLGFMELVM
SQAYTAKCNYEDTFGTVKYWETIIYNFLKDQGIQTPPQRLKSGNDKMKPIVGAYVKEPQVGGHDWVMSFDLNSLYPHIIM
QYNISPEKLVRGHREDVNVDRLLNKECDLSYCKQTNTTVAPNGVLFSRDKQGMFPELMETFYEERKEWKGKMIEYQKELQ
TCDDPKRKKELDTLIKRAFNNQMVRKIALNSAYGAMANQYFAFFSIDLAEAITTSGQMIIKWSEKTINEYLNKILKTDNE
DYVIAMDTDSVYITMDKFVNQIMPDAPKDKVIDFLTKVEVEIEKVLAQGFDELAEYTNAFQQKMQMGREVIADKGIWTAK
KRYILNVYDNEGVRLAKPKLKMMGIETAKSSTPQWVRNKLTEALNVVMTQTEQDLWEFVETARKEFRNLPPEEVAFPRGC
KGLAQYSDPNSIYAKGTPIHVRGSLLYNNLLTSKNLDMRYEMIKNSDKVHFTYLTLPNPINENVISFTTSLPREFDLHRF
IDYDMQFDKSFTEPLKNIVNLINWNVEPVASLDSFFA
>Pelagiphage_PMP-MAVG-26-KCKFIKKH_02308_DNA-directed_DNA_polymerase
MSRFYTNIIQWGNNLLLREIVNGERINRRVKYSPTMFCPVMRETKYKTLQGKYVMPVKHETIKEAKNWVQQYEDQPHLVY
GNTNFQFSYLYEQYPNLEWNMDEVLIITIDIEVACENGFPNPQEASEELLSITIKNQQNKQIFVWGVGKFKTERKDVVYI
ECDNEYELLTEFIKFWKLNQPDVITGWNTEFFDIPYLCNRIKKIMNEDTLKDLSPWRSVLSKTIYQMGRQYQVYDIQGVA
ALDYYDLYRKFTYTNQESYKLDHIANVELGIKKDENPHDTFRDWYTNDFQSFIDYNIKDVEIVDQLEDKMKLIELCLTMA
YEAKVNYVDVLGSVRYWDVLIHNYLMDKKIVIPQKTNKEKSDKYEGAYVKDPQVGEHKWVVSFDLNSLYPHLIMQYNISP
ETLKSDKTIPNMNVDKLLSKKVDTSILKDTTMTPNGALFRTDKKGFLPEMMQTMYEDRVKYKRAMLDAKQEYEKTKNPKL
LKMISKFDNIQMARKISLNSAYGAIGNNWFRYYNLPIAEAITTSGQLSIRWIEEKLNEYMNELLKTKDVDYVIASDTDSV
YIRFDELVEKFKPKNPVDFLDTIAKEKVEPFINKVYKELADYTKAFEQKMQMKREVIADKGIWTAKKRYILNAHDVEGVR
YKEPKLKIMGIEAVKSSTPAPCRENIKQALRIIMDGDEKELNTFIQNFRKKFLTLAPEDVAYPRGVNGLSKWTESHNLFK
KGAPIHVKGAILYNHLIKKNKLGYKYPLIQEGDKIKFLHMKLPNIYQSSSISFITKLPKEISFAVDYDLQFEKSFIEPLN
YIIEKIKWNVDRSYGTQGTLESFFA
>Pelagiphage_HOT_VTLG01002142-FGLCGAHL_00174_DNA-directed_DNA_polymerase
MINFYKSVIEHKGKLLVRGIHDGKDYKEKIDFGPTLYSITQKNTKFKTLDNRNLNPIKFKNINDARRFRRDVATDNSPIY
GLERFHYQYINDQFPKNIKWDKKFIKIFTMDIETTVTDGFPDVENPIEEIICITVKNQTNKQVITWGTGEYKTDRLDVTY
VKCKTEQHLIMEFMKFWLKNHPDVITGWNTKFFDLPYLMNRIKLIAGEKVATRMSPWNLIEKNEIIVRGRPQTTYTLKGI
VMLDYLDCYRWFIPTRQESYKLDFIGELELGKKKHVNPFETFKDFYEKDFQKFIDYNIQDVEIVDALEDKLGLIELALTV
AYESKVNYDDIFSQVRVWDTLIANHLLAKNICIPPREEHIKDTKYEGAYVKDPKVGQHKWVVSFDINSLYPHIIIQYNIS
PEKIIGQDPSGISVNKMLKRKIDLSYLKKENACVTPNGAKFKNDSQGFLPEMMETMYNERVVYKKRMLTAKKLYQKNKDP
ELLKEISRCHNIQWARKIALNSAYGAVGNQYFRFYDVRQASAITTTGQFIIRYIEEKVNDYMNKILESEYDYIVASDTDS
IYVTMDKLVEKTCQGKTNEQICNFIDKVVDSRVEPYIKKCFNELSEYSNAFKNCMVMKREIIANKGIWVAKKRYMLNVLD
DEGVRLADPKLKIMGIEAVKSSTPQVCRGKIKEAIQIIMNKDEPTLQKFIADFKKEFLEMAPEQISFPRSCNNIGKYRNP
ATIFSKGTPIHVKGSLIYNHKLKEMKLHKKYPYIKEGDKIKFLKLIQANPFRFDVISYITTLPFEFDLKKYIDYETQFEK
TFLDPMRFILQSIGWSQEKKATLEAFFG
>Pelagiphage_HOT_VTLG01012685-FGLCGAHL_02542_DNA-directed_DNA_polymerase
MNFYTYARHYGNDILFRGVKDGKRFTARRGFQPTLFVKSQEKSKYKSIFGENVSPMKFPTNKEATAFFDSYKDVDNFPIF
GQNYYAYQYITENYPGEIQWDANKMAIYSIDIETTSEGGFPNVDSPSEKVLVITLQNNNTKKITTFGLGEFTPTKETSHL
DIDYHGFDTEEQLLENFLTWWQENCPDIITGWNSNLFDMPYLITRVQRVLGEDEHKRFSPFKLINKRPIRFANREMTAFE
ITGVAQLDYLDLYKKFTYVTRESYKLDFIAETELGKNKLESGFDTFKEFYDGDWNRFVEYNIIDTVIVDELEDKMKLIEL
AITMAYDAKCNYNDVFSAVRTWDSLLYNHLWEKDIVIHQGGGRKDRQIEGAFVQEPVPGSYEWVASFDATSLYPSILMQH
NMSPETIVPGFKYDVSVDDQLDRYQLDKLKEKNYTMAGNGSCYTREKKGLFPEIVQKFFNDRLKYKKLMQKAQKDFQETG
ALHHKNEISKYNNFQMARKIQLNSLYGALANQYFRFYDDRIAEGITMSGQLVIRDTAKALDKYMNKVCGTEDEMYSFYSD
TDSCYVTCKNLVDNFFPDKDVDKVVGLLDKIGTEKIEPAIAQAMTKLGNYTNAFEHKIDFKREVIADKGVFVAKKRYALN
VLDDEGLRLKDPKLKVMGLEIVRSSTPAPIRDSLKEAVRLILTSDEEHLQKYIAEAQKHFNTLTAEDIAFPRGCNNLKKY
TSTADVYQKGTPIHVRGSLLYNKLLKDKSLNLKYENIQEGDKIKFLYLKEPNSLHENTIAFVTKLPKEFEITKYVDYDLI
FQKAFIDPLENILKPIGWNTEPQATLEDLFR
>Pelagiphage_PMP-MAVG-8-KCKFIKKH_03717_DNA-directed_DNA_polymerase
MKFYTSIQQFNNVILERYIEDGVHKQREVPYQPTLFVPTVKQSPFKTITGEVVEPRGFNSIKEARDFIQARDKVSNDPVY
GMQQFAYAYINEEYPTRDFDFSQLNIFNFDIETRSDEGFPNIQTANMDILSIAVRCNGQSYILGCQEYKTSGEDIYIKCA
SEADLLHKFIQLWKDLDPDIVTGWNIETFDIPYVCNRIERVLSKEAVNELSPFKLVRDRFFGRPSEGEQPEAKEIYGVTI
FDYLSLYRKFTYIQQESYALDYIGEAELGEKKLDYSEYGTLNELYKNDYQKFLDYNIRDVVLVEKLDDKMKLLEQACTIA
YDAGVNLIDSLTSVRMWDVIIHNFLMEKNIVVPPKQFGEKENQVEGAYVKDPQVGLHNWVVSFDLNSLYPHLIMQYNISP
ETYVRHIGQRPTADEIIAGLFDNENIKEFMKKHNVSVCGSGAMYTKDFQGFLPKLMETMYNDRVKWKTRMIEAQKKYQKN
KTKELEYEIAKCNNMQMAKKIQLNSAYGALGNQYFRFFDTKYAESITLSGQLSIKWMEVKINQFLNKKLKTEKVDYVVAV
DTDSLYVVLDTLVGQSGIDTNDTNKVINFLDKVASEVLEPFIDKGYRELANYVGAYEQKMVMKREAIADKGIWTGKKHYI
LNVYDNEGVRYQEPKLKMMGIESVRSSTPGVVRKAIKEALDVLMKDGEMALREYVNDFEKLFNAMPYEDVAFPRGCRYMR
KWSDASDIYKKGTPIHVRGALLYNKVVKEKKLDRKYNEIHEGDKIKFCYMKLPNPMRENVFAVPTVLPPELGMENYIDYE
KQFEKSFKDPLNHICEAVGWSIDKQATLDQFFV
>Pelagiphage_PMP-MAVG-3-KCKFIKKH_03317_DNA-directed_DNA_polymerase
MSKFYTNIIQWGNNLLLREIVNGERINRRVKYSPTMFCPVMRETKYKTLQGKYVMPVKHETIKEAKNWIQQYEDQPHLVY
GNTSFQFNYLYEQYPNLEWNMDEVLIITIDIEVACENGFPNVNEASEQMLSITIKNQQNKQIFVWGVGKFKTERKDVVYI
ECDNEYELLTEFLKFWKVNQPDVITGWNTEFFDIPYLCNRIKKIMGEETLKDLSPWRSVISKTIYQMGRQHQVYEIQGVA
ALDYYDLYRKFTYTNQESYKLDHIAKVELGIRKDENPHDTFRDWYTNDFQSFIDYNIKDVEIVDQLEDKMKLIELCLTMA
YEAKVNYVDVLGTVRYWDMLIHNYLMDKKIVIPQKTNKEKSDKYEGAYVKDPQVGEHKWVVSFDLNSLYPHLIMQYNISP
ETLKSERTVPNMNVDKMLNKSVDTSILENTTMTPNGALFRTDKKGFLPEMMQTMYEDRVKYKRAMLDAKQEYEKTKNPKL
LKMISKFDNIQMARKISLNSAYGAIGNNWFRYYNLPMAEAITTSGQLSIRWIEHKLNEYLNSLNQTKDIDYVVASDTDSV
YIRFDELVEKFKPKNPVDFLDTIAKDKVEPFINQSYQELADYTHAYDQKMQMKREVIADKGIWTAKKRYILNAHDVEGVR
YQEPKLKIMGIEAVKSSTPAPCREKIKQALRIIMDGDEKELNTFIQDFRKEFLTLPPEDVAYPRSVNGLSKWTESHNLFK
KGAPIHCKGAILYNHLIKKNKLGYKYPLIQEGDKIKFLHMKMPNVYQSSSISFITKLPKEISFAVDYDLQFEKSFVEPLN
YIIEKIKWNVDRSYGTQGTLEDFFA
>Pelagiphage_MAVG-MED-5-KCKFIKKH_00727_DNA-directed_DNA_polymerase
MNFYKSVIEHKGKLLVRGIHDGKDYKEKIDFGPTLYSLTKNQSKFKTLDNRNLNPIKFKNINDARRFRRDIATQNSPIYG
LERFHYQYINEQFPNKIDWDKKYIKIFTIDIETTCEDGFPDVENPIEELLCITVKNQTNKQILTWGTGDYHTDRTDVTYV
KCKSENHLLMEFMKFWLKNYPDVITGWNTKFFDLPYLMNRIKLVANEKVANKMSPWNMIEKNEIMVRGRPQTTYTLKGIV
MLDYLDCYRWFIPTRQESYKLDYIGEIELGKNKNENPYDTFKDFYTKDFQKFIDYNIQDVEIVDALEDKLGLIELALTVA
YESKVNYDDIFSQVRVWDTLIANHLLAKNICIPPREEHDKDTKYEGAYVKDPTVGQHKWVCSFDINSLYPHIIIQYNISP
EKIIGHDGSGISVNKMLKGSIDLSHLKNEHACITPNGAKFKNDSQGFLPEMMETMYNERVIYKKRMIKAKKEYQKTPTPE
LQREIARCHNIQWARKIALNSAYGAVGNQYFRFYDVRQASGITTAGQFIIRFIEEKVNGYMNKILQTEHDYIVASDTDSI
YVTLDKLVEQTCKGKDNEQICNFIDRVVNSRLEPYIEKCFSELAEYSNAFKNCMVMKREVIANKGIWVAKKRYMLNVLDD
EGVRLSEPKLKIMGIEAVKSSTPQVCRTKIKEAIKIIMNKDEETLQNYIAEFKKEFDELPPEAIAFPRSCNNIHKYKNPA
TIFSKGTPIHVKGSLIYNHKLREMKLQNKYPYIQEGDKIKFIKLIEANPFRFDVISYITTLPQEFDLLKYIDRETQFEKT
FLDPMRFILQSIGWSQEKKASLEAFFG
>Pelagiphage_PMP-MAVG-7-KCKFIKKH_05606_DNA-directed_DNA_polymerase
MHFYTNVYQHRNLILVREFKDGEYIQKQVQYKPTFYVPTNKDSSFRSIKGKNLEPKKFSSIAQARQFREKWKGVEGFDIH
GIERHPYAYIAEYFPQEIEWMMRHIRIMNLDIECECEDGFPEPTEAAEEINAITYKFFGQDTKYVFGTQAWEHNDPTIKY
FHCRNEKQLLKTFLEEYKKNYPDIITGWNVDQFDITYLYNRINKLFGSTIADQLSPWNITTVREWDTFNKKQQAYTLTGI
EVVDYLQLYQKFTFKRRDSYKLENICQIELGKGKINYEEFGAMHLFYKKDYQKFLEYNVRDVTLVEELEDKLGLMGLLLA
MSYSAKCNYLDAFRQVRYWDILIFNRLKQQNIIVPPSRTGQPKKQKFMGAYVKEPQVGMHEWVVSFDLNSLYPHLIMQYN
ISPETSVESSDVTLSIDKMLNKEIDIQSHYATTPNGARFSKRKQGFLPEILENLYDERVLWKNKMIEYQKEFESTDDPKR
KQELNRQIAIAYNNQMVRKISLNSAYGAIGNEWFRYFELSLAEAVTSSGQLAIKWVEKAVNMYLNTILDTEDDYVVAIDT
DSIYVRFDELIKKVNPKNPIDFLDQVAKGKMQDVINKCYEDLADYTNAYQNKMVMGREVIADKAIWTAKKRYILNVHDNE
GVRLHEPKLKMMGIETAKSSTPAWVRDKLEDALKVVMKGDEKLVHEFVDNARKEFKGLEPNDIAFPRRVNGINEYENAVT
IYKKSTPMHVRASLLYNHYLGKKDIGMKYENISSGEHMKFLYLKIPNPIKENVIGFINTLPREFELHPYIDYDLQFDKSF
IEPLKLILEKIGWSTEPVSSLEDFFS
>Pelagiphage_PMP-MAVG-9-KCKFIKKH_01365_DNA-directed_DNA_polymerase
MNFYTNVTRYGNMILYRGYENGKKVSHKIKYAPTLFVSSPKGEWTSLNGVKCAPIKFDSMRDAKGWVDENKQVAGRKIFG
NTRYISSFINEYFPGVIKFDRNLINVTTIDIEVASDDGFPEPEEASKEITAICLKNNIDNTYYVFGVGDYDVSQALMKTN
RVVYIKCLNEAMLLQKFLEHWATPSNTPDVITGWNSRFFDIPYLVNRINRLMPGEEKKLSPWGMVDERIINSFQRKQQTY
EIGGIEHLDYLELFKKFGYSYGPQESYSLNHISHVVLGEKKLSYEEHGDLFSLYKFDYQKFIDYNIKDVELVDRIEDKTG
LITLAMTIGYKGGVNYGDTFGTTAIWDTIIYRDLYANKIAIPFAEDKMKTPYPGGYVKEPIVGLHRNVVSFDLNSLYPSL
IMQYNMSPETIATGETAPLNVDMILNNPSVVDNRGKAVAANGQYFNINKLGVLPKIINDLYTERVDIKQSMLKAQRELQK
ADKNDKQDIYRIERDITINENRQMAIKILLNSLYGALGNKYFRFFDQRIAEGITLSGQLTIRWAEQAVNGYLNRLLNSST
NNNPKDYVIAIDTDSVYVSLDDLVQKFKPTNTTDFLDAVCKDKIEPVLKESYARMFDILGGIENKMVMGREVIADVGIWT
AKKRYILNVQDNEGVRYAEPKLKIMGIEAIKSSTPMPCRDALKAIFKEIVSGSESQVQTSIDQFKTYFKSLPPDQIAFPR
GISKISAYKDNQLIYKKGTPIHARGGLLYNKLLTDLSLQKKYQQIGNGEKIKFVYLKTPNAIKENVISFPEYLPEEFGLL
RYIDYDLQFQKTFLDAIDPILDAIGWSSKEIATLNDFFA
>Pelagiphage_PMP-MAVG-12-KCKFIKKH_05754_DNA-directed_DNA_polymerase
MEFYKSVIEHRGKILVRGVLDGKEYNERLNFKPKLYVLSQEESTWKDLKGRNLKEINFDSIHKAREFKKSYATSNSPIYG
LDRYQYQYISDNFPGEVEWNKDHIKIFTIDIETTCEDGFPDVENPQEKLLVITVKNQTNKHIITWGVGDFKTDRTDVTYI
KCKTEKHLIMEFMKFWIKNYPDVITGWNCKFFDLPYLVNRIKLLTDEKVIKKLSPWNIVEEQKVEVRGREQTVYTLFGIS
NLDYLDLYTRYIPQRQESYKLNFIGNVELGTGKDDNPYETFKDWYTKDFQSFVDYNIQDVEIVDGLEDKLGLIELLLTMA
YDARVNYLDIFSQIRVWDTYIYNHLKDRGIQIPPKEHHTKDEKYVGAYVKDPIVGMHKWVVSFDLNSLYPHLIMQYNISP
EKYVGQDSTGVSVSNMLKKKVDTAFLKEKGITMTPNGARFKTDSQGFLPKMMEDMYNDRKKFKRLELQASQQYENDKTKT
ELKKTISRYHNIQWSKKIALNSAYGAIGNQYFRYYDVAQASAITTSGQYVIKWIENKMNDYLTKVIGEEGDYIVASDTDS
IYVTLDKLVEKICKDKSKEQIVKILDKICTEKFEPYIDKCYAELADYSNAFQQKMEMAREVIADKGIWVAKKRYMLNVHN
SEGVQYAKPKLKIMGIEAIKSSTPEICRTRIKEAITIIMEKDETDLQKFIADFRQEFAGLEPEQVAFPRSCNNLRKYADS
SNIFQKSCPIHVKGALIYNHYLREMKLTRKYPEIQEGDKIKFILMKEPNPFKHGVISYITTLPKEFDVHRFIDYDTQFEK
TFLDPMRFILEAINWKAEKVASLEDFF
>Pelagiphage_MAVG-MED-2-KCKFIKKH_00224_DNA-directed_DNA_polymerase
MYAQTQDETNHKTLQGNNLKPITFESISKAREFKRSYATSNSPLYGNDRWHFQYISKEYPKQIEFDKSLIKIFTIDIETT
AEGGFPDVENPTEEIICLTIKNQSNKQIITWGTKPFLVKQDNVTYVECANEKQLLMEFFKFWMKNYPDVITGWNTKFFDI
PYLCNRTKRLVGDKVINKLSPWGLIEEEKLTVRGRQQTIFKITGISNLDYLDLYIKFIPTRQESYKLDYIAKVELGGDGK
DNNPYETFREWYKNDFQSFVEYNIKDVELVDKLEDKLRLIELIMTMAYEAKVNYTDVFSEVRLWDTLIYNHLLKDNVHIP
PRTDNIKEEKYVGAYVKTPQVGQHKWIVSFDINSLYPHLIMQYNISPEKMIGVKPNGISVDKLLKHATPLTHLQTQGATI
TPNGAMFKTDSQGFLPKIMEGMYNDRVHYKQLEFQAKKEFQKTKDPIYEKEISRCHNIQWAKKISLNSAYGAIGNQYFRF
YNVNQASAITTAGQFIIQYVEQQVNKYVNDILQTKDKIDYIVASDTDSIYLCLDKLVDKFCKDKTKEQKLNFVDKVAKGK
IEPFIEKCFEEVAGYTNAFQQKMVMKREVIADKGIWTAKKRYMLNVLDEEGFRFEEPKLKIMGIEAVKSSTPEVCRVAIK
EAIRLIMNKDEDALHNYISDFKEIYKKYEPEQIAFPRSCNNLRKYSSSSDIFIKGTPIHIKGSLIYNWHLKNQNLDQRYP
LIQEGDKIKFILLKEPNPFKFNVCAYLSTLPREFKLQDYIDYEVQFEKTFLDPMRFILGAIGWHAEPQASLEAFFG
>Pelagiphage_PMP-MAVG-6-KCKFIKKH_03139_DNA-directed_DNA_polymerase
MHFYTNVYQHRNLILVREFKDGEYIQKQVQYKPTFYVPTNKDSSFRSIKGKNLEPKKFSSIAQARQFREKWKGVEGFDIH
GIERHPYAYIAEYFPQEIEWMMRHIRIMNLDIECECEDGFPEPTEAAEEINAITYKFFGQDTKYVFGTQAWEHNDPTIKY
FHCRNEKQLLKTFLEEYKKNYPDIITGWNVDQFDITYLYNRINKLFGSTIADQLSPWNITTVREWDTFNKKQQAYTLTGI
EVVDYLQLYQKFTFKRRDSYKLENICQIELGKGKINYEEFGAMHLFYKKDYQKFLEYNVRDVTLVEELEDKLGLMGLLLA
MSYSAKCNYLDAFRQVRYWDILIFNRLKQQNIIVPPSRTGQPKKQKFMGAYVKEPQVGMHEWVVSFDLNSLYPHLIMQYN
ISPETSVESSDVTLSIDKMLNKEIDIQSHYATTPNGARFSKRKQGFLPEILENLYDERVLWKNKMIEYQKEFESTDDPKR
KQELNRQIAIAYNNQMVRKISLNSAYGAIGNEWFRYFELSLAEAVTSSGQLAIKWVEKAVNMYLNTILDTEDDYVVAIDT
DSIYVRFDELIKKVNPKNPIDFLDQVAKGKMQDVINKCYEDLADYTNAYQNKMVMGREVIADKAIWTAKKRYILNVHDNE
GVRLHEPKLKMMGIETAKSSTPAWVRDKLEDALKVVMKGDEKLVHEFVDNARKEFKGLEPNDIAFPRRVNGINEYENAVT
IYKKSTPMHVRASLLYNHYLGKKDIGMKYENISSGEHMKFLYLKIPNPIKENVIGFINTLPREFELHPYIDYDLQFDKSF
IEPLKLILEKIGWSTEPVSSLEDFFS
>Pelagiphage_HOT_VTLG01010903-FGLCGAHL_01896_DNA-directed_DNA_polymerase
MTEFFTNVERYKNDILYIGYKNGKRVQQRIPFRPTLYLPTKNSTNLAGLDGRPIAPRDFRSMGDCNAFIKQNGEISNFLM
YGLSNFPEQYIAQRFPDGCEDTFDRDVLNVTFIDIEVESDDGFPQPELAEKAVTAICVKNNIDNIYHVFGCGNYTEHRDD
VKYHKADGEKNLLKEFLTFWVSNPPDILSGWNSHYFDIPYLVNRISKVLGYEWNEHLSPWGLPPDQRSFGNNDMNFEIPG
IQSLDYLPLFKKLGYTYGTQESYKLDNIANVVLGEKKMDYSEYGSLFSLYKEDFQKFIEYNVKDVELVQRMEDKLQLLTL
CLTLGYKANVCAGTSMGSVKIWDCYIYNVLKRINIIIPFVPRRDSDRSIEGAYVKEPIVGMHDWVVSFDLNSLYPSIIRQ
YNMSPETIIDGVIDNVSVNTVVANEPFTVPDGQILCATGQTFNANQKGIFPAIVEKLYNERVKIKQKTLALKSEAQKVKG
VERAKIMHEVASLDNNQMAIKIMLNSLYGAMSNKWFRYYDNRIAEGITITGQATIRWGENAINNYLNKVLKTENKDYVIA
IDTDSLYVNFGGLVDHVYDGLADHTVITDFLDKVSKEKIEPLLENAYIDLQKKMNCPTNIMEMARECIASRAVWTGKKRY
VMNVYDNEGVRYTEPQIKVTGLESVRSSTPQVCRKMIEETMSLILRENEKAVQDFILSARNEFQTLPAEDVAFPRGVNNV
KQYSSRNEIYKKSTPMHVRAAILYNKMIQDRKLTKKYELIGDGDKMKFIYMKKPNPNQENVLAFPDILPPEFEFEKYVDY
ETQFLKAYLEPINSILDAVGWSSEERSTLEDFFS
>Pelagiphage_PMP-MAVG-19-KCKFIKKH_04955_DNA-directed_DNA_polymerase
MINFYTNILQWGNQLFLREVVNGKRQVRKVKYQPTLYTPCEKVSGFKTLTGKNAAPIKFDNIKDAKEWQKSYENQKSLVL
GLNQYPYTYLSEEYPNDVNWDLDQILIYTIDIEVKCENGFPNPQEAAEPFLSITLKNHSNKQIIVWGVGKYTNSRDDVTY
IECESEIHLLKEFLIFWENSPPDIITGWNTEFFDIPYLCNRMKNLFGEDELKRLSPWRMVQDKEVFRNGRNHQLYDIRGV
AHLDYLDLYHKFTYTSQESYALTHIAYVELGQKKDTNPYETFSEWYTKDFQSFIDYNILDVELVDRIEDKMRLIELCLTM
AYEAKVNYMDVLGSVKYWDVLIYNYLKKKNIVIPQKRHSEKAEKFEGAYVKDPIVGEHKWIMSFDLNSLYPHLMMQYNIS
PETLKSLDTVKGMKVDKLLNKEVDTSIFKDTTMTPNGALFRTDTKGFLPELMENMYNDRVVFKKKMLQAKQEYEDTKEPK
LLKKISKYDNIQMARKIALNSAYGAIGNQYFRYYSLAMAEAVTTSGQLSIRWIENKINSYMNNLLKTDNQDYVVASDTDS
IYVTFGSLVEKFNPSSPIDFLDSIAKDKIEPYISSCYEELATYMKAYQQKMEMSREVIADKGIWTAKKRYILNVWDNEGV
RYQEPKLKIMGIEAVKSSTPEPCRNKIKEGLKIIMSGDEKMLNKFIRDFREEFMNMPAEMIAYPRSVNGLTKWSDPSSLF
AKGAPIHCKGAILYNHLLKQKKLVNKYPYIQEGDKIKFLHLRIPNAHQSSSISFITKMPDEFGLQSMIDYEQQFEKSFVE
PLNFIVSKLKWTVDRTYGQQGNLMDFL
>Pelagiphage_PMP-MAVG-4-KCKFIKKH_02721_DNA-directed_DNA_polymerase
MNFYKNVIEHKGKLLVRGVRDSKEFKERINFSPTLYSVSQHQEEFKSLQGHNLRPITFSSIDAARRFKRDVATKNAPVYG
LDRFHYQYINEKYTKQVKWSKELIKIFTLDIECTCENGFPEVNTPVEELLCITVKNQSNKQIITWGVGEFKTLRTDVTYI
KCTDERHLIMEFMKFWLKNYPDVITGWNTKFFDLPYLMNRIQLVAGAKVASRMSPWNLIHKEEIIIRGRPNTYYSLFGIA
MLDYLDLYKWFIPVRQESYRLSFIGETELGETKVENPYPTFKDFYTKDFQKFVEYNIQDVEIVDGLEDKLGLIDLSLTFA
YETKVNYNDIFSQVRVWDTLIANHLMTKKICVPPREDHIKDTKYEGAYVKEPRLGMQKWVVSFDINSLYPHIIVQYNISP
EKILGVKPSGVSVNKMLSKKTPLDYLKTEGACITPNGAMFKRDSQGFLPEMIEKIYKDRVIYKKRELKAQREYQKNPTNE
LKKEIARCHNVQWARKIALNSCYGAIGNQYFRYYDIAQASAVTTAGQFIIRFVEQKVNEYLNQILQTHNEIDYVLASDTD
SIYVSFDKLVEKTCKDKTDQQVCDFLAKVCDNKLEPFIAKQFEDIADYTNAFKNAMVMAREVIANKGIWVAKKRYMLNVL
DEEDVRLSEPKLKIMGVEAIKSSTPQVCRGKIKEAIKIIMSKEQSDLHTFIAGFKKEFMSMSAEQISFPRSCNNMRKYAS
SKDVFIKGTPIHVKGSLIYNHQIKEFGLQNKYPYIQEGDKIKFIKLLQANPFKFDVISYITKLPKEFNLQEYIDYEVQFE
KTFLDPMRFILNSIGWEHEKKASLEAFLG
>Pelagiphage_PMP-MAVG-10-KCKFIKKH_01766_DNA-directed_DNA_polymerase
MKFYTSINRFGNELLYRGYNNGRPEKYRVRFEPTLYLESKQETNYKSIFGQNLFPKSFDTMRDANDFAKMYKEVKDINVY
GTTNYIHQFIAERYPNDIEFNIDDINIVNFDIEVASDDGFPEPKDAAHPIISITLKSSKTNIYYVWGLGEYDADKTEIEL
YGNVIKYEHCASEKELIAKFLHHWVNDYPDVITGWNSRFFDIPYLVNRICVISSESLMKKLSPWNQVNEKVIKIRSFNNK
VLQTYDIVGVQQSDYLELFRKFGYSYGTQESYRLDHIGYVVLGERKLSYDEHGSLHTLYKEDHQKFIDYNIKDVQLVERI
DKKMGLISLALTMAYKGGINLQDTMGTTVIWESIIYRRLLKKGIISPVEQVEQIPYHVVGNPDLVLDDAKSIAGGHVKTP
ETGFHDWVVSFDLNSLYPNIIVQQNISPETIAAARFPQGTNYYLNDHNREKQVSDKYAVCSSGISYRKDKQGIIPELIVD
YYAERTVIKREMLKLQSEYEKTKDSNLEFEINQLENNQMSVKILLNSLYGAMANKYFKYFDNALAESVTLTGQTVIQWAE
KAINISLNKLLKTDNVDYVIAIDTDSVYINMSGIVEKFKPTNPVEFLDKISNEVIEKILKKAFDEFYFVTNGYTPRMEMA
REVIADKGVWTAKKRYILNVHNSEGVQYAEPKLKIMGIEAIKSSTPEVVRDKFKEVFKIIMTQTESDVQNFIANFKQEFK
SLSPEQVSFPRGAQNIGKWKDSTTIYAKATPIHVRGALLYNHHVKENNLIKKYETIKDGEKVKFCYLKTPNRIKENVIAF
PNNLPRELGLHEYIDYDTQYEKAFVDPLRLILEAIGWRTEAVSSLDDFFA
>Pelagiphage_HOT_VTLG01016107-FGLCGAHL_03422_DNA-directed_DNA_polymerase
MKLFGDDTIHVIGTDDFDFKTDNPNVKYYKCKHELELLKTFMNVWKELDPDIITGWNVETFDIAYLINRIWKLFNWDTVT
ELSPHKLITSREWFYMGQKKMISYNISGIAVLDYLQMYKKFTYITRETYRLDHIAEVELGKKKIDYSEFGAMHLFYRNDY
QKFLEYNIRDTELVEELDDKLKLMDLVITMAYSAKCNFDDVFGSVRYWDLLIYNFLKKKGMVPPPKKGSQDSRIIGAYVK
EPQIGQHKWVMSFDLNSLYPHLIMQYNMSPDTYLLHKFNQEISVKQLLEGEVDITSLTNTTVTPNGAMFNIDRQGFLPEL
LEEMYDERVLFKNKMIQHLKELENTPKEDTVTRKKLEYSITAENNNQLARKISLNSCYGALGNQYFRYFNRDIAEGITTA
GQLSIKWVEKAVNDYINKLLETDDDYVVAIDTDSIYVSFENLIDKVNPKNPVEFLDTIAKDKLEPMINDSYEELASYMNA
YQNKMVMGREVIADKGIWTAKKRYILNVHDSEGVRYKTPKLKLMGIETAKSSTPMWCRKKLEQGIRVVMNETESDVWEFI
TDAWNEYKTLPIEEISFPRGVQNVTNYYNSASIYKKGTPIHVRGSLLYNNYLHKYNIDKKYPVITNGEKIKFCYLKVPNV
INENVISFVNTLPKEFELESFIDYDLQFNKSFVEPLGVILDKIGWTTEPVSNLDNFFG
>Pelagiphage_PMP-MAVG-21-KCKFIKKH_02510_DNA-directed_DNA_polymerase
MNFYKNVIEHRGKLLIRGIHEGKEYKNKIDYSPTLYAKTQDDTGFKTLQNENLKPIKFDSISKAREFKKTYNTGSSPLFG
MDRYQYQYIADEYPETMKFDKDLIKIFTVDIECTAENGFPDIENAIEELLAITVKNQSNKQIITWGTGDFKTDRSDVTYI
KCKSEKSLIMEFMKFWTKNYPDVITGWNTKFFDIPYLFNRIKNLVDEKVLKKFSPWNLVEKETVVLRGRPQTHYNIFGIA
MLDYLDLYQKFIPTKQESYKLDYIGKVELGLQKDENPYDTFSDWYKKDYQSFIDYNIKDVEIVDRLEDKLKLIELVLTMA
YEAKVNYADVFSQVRMWDMLIYNYLKKDNIQIPPRENYTKDDKYEGAYVKDPITGMHNWIVSFDINSLYPHLIMQYNISP
EKIIGVKSDGISVDRLLDHATPLDHLKAEGACITPNGAMFKIDSPGFLPKLMESMYNDRVKFKTLSFQAKQEYQKTKDKS
LLKEISRCHNIQWAKKIALNSAYGAIGNQYFRYYDVRQATAITSAGQFVIRWIEKNVNEYMNTILKTEEKVDYIVASDTD
SIYLCLDKLVEKVCKDKSKSETLKFLNKVVESRIEPFIDKKFEELAEYTNAIKQKMVMKREVIADKGIWTAKKRYMLNVL
DEEGITFEEPKLKIMGIEAVKSSTPEVCRGKIKEAIKLIMTKGEDELQAFVAEFKKEFYQMTAEQISFPRSCNNLKKYKH
SSNIFIKGTPIHVKGALIYNENLKRFKLHRKYPLIQEGDKIKFLKLKEANPFKFDVISYVTKLPSEFTLQEYIDYDIMFQ
KTFLDPMSFILNSIGWTYEKTASLEDFFV
>Pelagiphage_HOT_VTLG01010876-FGLCGAHL_01633_DNA-directed_DNA_polymerase
MAPLFNYEKGNMNDFYTNIQVIGDEMLVRAIVDGKKEKYREEFYPTLFCPTKNPTKFRTLDGKVIDKIQPGTISECRNEV
RKWKNSYNINLYGSTDWVCQYIGKEFDQCKYDLSKVRVMNIDIECGSESGFPTVREAKEKLIAITFKDSETGKFVTLGCG
NYVNTRDDVFYVKCADEVSLIRRFIEIYQTIEPDVITGWNTKWFDLPYLIRRINNVLGESESKFLSPWGLVKEKIDKWMG
REHIVYHISGVSQLDYFLLYKKFTYVNQSRYTLDHIADVELGEGKLSYKEHGNLHNLYKEDYQKFIDYNLKDVELVDKLD
EKLKLIDLTCTMAYDAGTNFEDVLGQTRYWDAFIYHHLRRKNIVIPPKREVEKKEREYEGAYVKDPLVGLHDWVVSFDLN
SLYPHLIMQYNISPETFLKDVPRFFVDVDELMKGKTSLPEEPDACMAGNGYFFSTKEKGFLPELMEEMYNDRVKYKDLMF
DAIKAGDKDKIAQYNTIQMAKKISLNSAYGAIGSEYFRYYDLRQAEAITKSGQLAIRWIERKMNDYLNNILETEDEDYVI
ASDTDSIYVTLGSLIEKVMPDASTDKIVDFIDTICNDKIEPYIDKSFEELAEYMKSYRQKMIMKREVIAEKGIWTSKKRY
VLNVWDNEGVRNEEPKIKIMGIEAVRSSTPQSCRDKILESMKIILNGDEDELIEYIEAFKKNFKDLPTEDISFPRTVSGL
KKYFDSVHGYIKGTPIQVKGSLIYNQILNDKNLSMDYQTIKEGEKIKYTYLKEPNPTRDRVIAFVDTLPEEFGLDKYIDY
DLQFEKSYIDPIKTVTNVIGWNHERISTLEGFFG
>Pelagiphage_PMP-MAVG-5-KCKFIKKH_04249_DNA-directed_DNA_polymerase
MHFYTNVYQHRNLILVREFKDGEYIQKQVQYKPTFYVPTNKDSSFRSIKGKNLEPKKFSSIAQARQFREKWKGVEGFDIH
GIERHPYAYIAEYFPQDIEWMMRHIRIMNLDIECECENGFPEPTEAAEEINAITYKFFGQDTKYVFGTQAWEHNDPTIKY
FHCRNEKQLLKTFLEEYKKNYPDIITGWNVDQFDITYLYNRINKLFGSTIADQLSPWNITTVREWDTFNKKQQAYTLTGI
EVVDYLQLYQKFTFKRRDSYKLENISQIELGKGKINYEEFGAMHLFYKKDYQKFLEYNVRDVTLVEELEDKLGLMGLLLA
MSYSAKCNYLDAFRQVRYWDILIFNRLKQQNIIVPPSRTGQPKKQKFMGAYVKEPQVGMHEWVVSFDLNSLYPHLIMQYN
ISPETSVESSDVTLSIDKMLNKEIDIQSHYATTPNGARFSKRKQGFLPEILENLYDERVLWKNKMIEYQKEFESTDDPKR
KQELNRQIAIAYNNQMVRKISLNSAYGAIGNEWFRYFELSLAEAVTSSGQLAIKWVEKAVNMYLNTILDTEDDYVVAIDT
DSIYVRFDELIKKVNPKNPVDFLDQVANGKMQEVINKCYEDLADYTNAYQNKMNMGREVIADKGIWTAKKRYILNVHDNE
GVRLHEPKLKMMGIETAKSSTPAWVRDKLEDALKVVMKGDEKLVHKFVEDARTEFKGLESNEIAFPRRVNNVFEYENAVS
IYKKGTPMHVRASLMFNHLVKQKGLDMQFEPISSGENIKFLYLKIPNPIKENVIGFINTLPREFELHPYIDYDLQFDKSF
IEPLKLILEKIGWSTEPQSSLEDFFS
>Pelagiphage_HOT_VTLG01012672-FGLCGAHL_01996_DNA-directed_DNA_polymerase
MYQNIYFDNRKQKVHLWDDKKGYLIIPYKKYAYVKNSNGQHVSLYGDRVKKVFNYDKEDPTLHESDVPPTTRFLVDQYTD
SDEVSEGHRKIFFDIEVEVTDGFPDVMKANNVITSIALYDFLTEKYYTYVFDAKKRLQSYTKDNQFVEVYDTEYEMLNKF
FQKYLEIKPTILSGWNSDYFDIPYLYNRAVNVLGVSVANLLSPISQVFYNEFKKRYVIAGVSCLDYLSLYRKFSFSQQSS
YRLDYIGEVEVGMKKVSYEGTLNDLYENDLQTFIDYNIRDVKILVELDKKLNLIEISRGIAHLGHIPYEEVFMSSRYLEG
AILVYLKKLGIVAPNKPPRPKKFLDDKFAGAYVQSPQAGKHDWVYDLDITSMYPSVIRSLNISPETKLGKVEGWDAEEFL
KKGLTKTYTMNNNKEKEIGKFTNGELENYLITNKISIASNGVMYRTDKQGLIPALLTKWFNERVEMRKLVKKYNEEGNKE
LEDYFDRRQYIQKIILNSLYGVLGLSVFRFYDLDNAEATTLTGQALIKFSKKITNHFYNKELGDNDDYVIYIDTDSIFAS
AIPLIKKRFPKDKLSEAMMTQRILEVCGEVQDYLNQSYNYFAKKFLNLDEHVFDIKQEVIAKSGLFITKKRYGLRIINDA
GRKVNKIHVKGLDTVRSNFAVAMKDLLSKVLEDILANVPKEKIDERISIFKRNMNSLHFDVMANPIGVKGIGKYEVKVED
SAFSVYKKGTPVHVKSAINYNSLLDYWYEGRKYEKITNGSKIKWVYLKNNEFGFDTIGYKGYEDPPQILDLIKTHIDHER
MFQQAMSKKIGMFYKAMKWEKVVDNRKSIERFF
>Pelagiphage_HOT_VTLG01012686-FGLCGAHL_02738_DNA-directed_DNA_polymerase
MNFYKDVIEHRGNLLVRGIHEGKEFKEKINFKPTLFSITHEDSPHKNLQGQNLKPITFNSIPKAREFKRNYQNSNSALYG
NERYHFQYIAEEYPGDIQYDKNLIKIFTLDIEVTAEKGFPDVENPIEEILCLTIKNQSNKNIITWGTKPYFSKRADVTYI
ECQNEKQLLMEFFKFWTKNYPDIITGWNTKFFDLPYLCNRIKLLVGDKVINKLSPWGLIDSEQITVRGQTQTAYDIKGIT
MLDYLDIYKKFIPVRQESYKLDYIAKVELGSNGKDANPYDTFREWYTNDFQSFVDYNIKDVEIVDELEDKLKLIELVLTM
AYEAKINYQDVFSEVRLWDTLIYNHLLKDNIQIPPRIEQAKDEKYVGAYVKSPQVGQHKWIVSFDINSLYPHLIMQYNIS
PEKMVGVNPEGISVNNMIKKKVELNYLKDKGCTITPNGAMFKIDNQGFLPKIMEKMYNDRVEFKKLEFEAKKNYQKTKDP
IYAKETSRCHNIQWAKKISLNSAYGAIGNQYFRYYNVNQATAITTSGQFIIQYIEKKVNEYMNNILKTKQDYIVASDTDS
IYLRLDELVNKVCKDKTKEQTINFINRVVDSRIEPFIEKCFNELADYTNAIGQKMVMKREVIADKGIWTAKKRYMLNVLD
EEGFRYEEPKLKIMGIEAVKSSTPEVCRVAIKEAIRLIMNKEESDLQNFIANFKKKFTDFEPEQIAFPRSCNNLRKYYSA
STIFIKGTPIHIKGSLIYNYHLKDKRLDHKYPSIQEGDKIKFVLLKEPNPFKFNVCSYLATLPREFELKEYIDYELQFEK
TFLDPMRFILGAIGWNAEPKASLEAFF
>Pelagiphage_Med-Io7-70mDCM-C14-KCKFIKKH_00895_DNA-directed_DNA_polymerase
MSYYTNVKAVGNNIFLRYIDDEGNRKNTKEKYTPTLFVPTKEQSKYKTMHGKPVKPIQLDSLNAARGFIEKYKDISNYKI
YGNDNFAFTFVGDEYPDEIEYDINKLVIANIDIEVASDEGFPNVDLAGSPVISIAIKFNDDFYVFGFNEPDDCPIEDTLA
KKQVKYVSCENEIDLLTRFIECWELHCPDIITGWNVGGFDIPYLYNRIIRLFDEKTVKRLSPWKYVSSRKFRSAYGQEQT
KIDISGISVLDYIELYKKFTYVNRESYRLDYIANVELGERKLSYSEFGSLHTLYKRDYHKFIEYNVKDVELVDRLESKMK
LIEMAIALAYSAKVNFMDVFSQVRMWDSICYHHLRKKNIVIPPRQVGDKTSKFEGAYVKEPQVGIHNWVVSFDLNSLYPH
LMMQYNLSPETLVASESVSKDLVSSLAFDGYNKIISKDFDTSLLVRDNLTVAPNRVFFRKNTQGFLPEILNDLYNKRKSS
KKKMLECQQKAERSSGEERRQYLNLISKHNNDQLARKVQLNSAYGATGNQYFRFYDLRIAEAVTKAGQLSIRWIESKMNK
YLNKLLETTDEDFVVASDTDSIYLSLDKLVTNSFGANLKEIEAEQVVDFLDKVCSKKIEPYIDECYQELADYMNAYAQKM
VMKREVIASRGLWTAKKRYVLNVYNNEGVSYSTPKLKVMGLEAVKSSTPEVCRDKIREALSIIMTKTEDDIIEFVESFKE
EFNTLPAEDIAFPRGVNGVLKYSDSGTYIKGTPIHVKGSIIYNNLIREKGLGLNYQRITDGDKVKFLYLVKPNPIRESVI
SIVNNLPEELGVTKYIDYEKQFVKAFLDPIKVMLDCVGWKAEKTSTLERFFV
>Pelagiphage_PMP-MAVG-11-KCKFIKKH_05426_DNA-directed_DNA_polymerase
MHFYTNVYQHRNLILVREFKDGEYIQKQVQYKPTFYVPTNKDSSFRSVKGQNLEPKKFNSIAQARQFREKWKDVEGFDVH
GIERHPYAYIAEYFPQDIEWMMRHVRVMNLDIECECENGFPEPTEAAEEINAISFKMFGKDTKYVFGTQAWEHNDPTIKY
FHCQNEKQLLKTFLEEYKKIYPDIITGWNVDQFDITYLYNRISKLFSTTIADQLSPWNITTVREWDTFGKKQQAYTLTGV
EVVDYLQLYQKFTFKRRDSYKLENISQIELGKGKINYEEFGAMHLFYKKDYQKFLEYNVRDVTLVEELDDKLGLMGLLIQ
MAYTAKCNYLDAFRQVRYWDILIFNRLKQQNIIVPPARGGAPKKQKFMGAYVKDPQVGMHEWVMSFDLNSLYPHLIMQYN
ISPETFSGMTSDTSNVDMMLNKEVRTNTLFAQTPNGAKFSKRKQGFLPEILENLYDERVLWKNKMIEHQKEFESTDDPRR
KQDLNREIAIAYNNQMVRKISLNSAYGAIGNEWFRYFEIGLAEAVTSSGQLAIKWVEHAVNKYLNTILGTEDDYVVAIDT
DSIYVRFDELVKSVQPKNPIEFLDQVGNGKMQEVINKCYEELAEYTSAYQNKMVMGREVIADKGIWTAKKRYILNVYDNE
GVRLTKPKLKMMGIETAKSSTPQWVRERLEDALKVVMKGDEKLVHEFVDNARKEFKELDPYDIAFPRRVNNLIEYENAVS
IYKKGTPMHVRASLMFNHLIVQKGLDMQFEPIQSGENIRFLYLKVPNPIKENVVGFINTLPREFNLHSYIDYDLQFDKSF
IEPLKLILEKIGWSTEPQSSLEDFFN

·

Basic reporting

This is an interesting paper, which further describes the diversity of T4-phages in Lake Baikal and describes these phages in comparison with previous studies across the globe.

The English is throughout good, but there are some minor issues (for example line 36, 113, 383) that would be improved if a colleague that is proficient in English read the manuscript. Also, the logic of the order of paragraphs in introduction, results and discussion could be improved to increase the readability of the manuscript.

The introduction does contain relevant information and puts the work in a broader field, the aims are however misguiding. While the manuscript briefly touches upon differing diversity between fractions, it is very brief and most of the paper discusses diversity and biogeography. The aims should be rewritten to correctly reflect this.

Figures are fine and raw data are supplied appropriately.

The authors sometimes refer to previous papers as if the reader should just have read them, it would be easier to follow with some more explanations of what has previously been conducted and what is of importance for this study.

Experimental design

This research does fit within the scope of the journal, but the identified research gap is not fully explored. The authors aim at describing the diversity in a fraction larger than 0.2/0.4 µm compared to the smaller fraction, but limit their own samples to the larger fraction and compare their result to previous results. Due to the large variation and diversity of viruses and their communities, this approach is limited since the communities might have shifted due to time and not fractions. However, they do not find any obvious differences, but they also limit their study to PCR results from a marker gene - which might not be the best way to capture full diversity. The other aims of the study are not as novel, to describe the diversity and put it in context, but are more well explored and still interesting.

The methods, especially with regards to statistical processing, should be further described to enable replication of the study.

Validity of the findings

The study and its findings are mostly descriptive, and the statistics that are used are not fully described, which should be expanded for full understanding. The study does provide further information about diversity of phages in the environment, which is relevant for future research, especially concerning freshwater habitats. However, due to the above mentioned issues with the aims of the study, the conclusions are not as well stated and linked to the research question as could be wished for.

Additional comments

Further comments are within the annotated pdf.

Reviewer 3 ·

Basic reporting

Overall comments -

I have read the manuscript by Potapov et al., and appreciated its interesting premise, which has the potential to generate relevant findings for the field. However, as written, the manuscript does not effectively communicate the motivation behind the study, or link this with the methods used, the results, or the conclusions. One of the main problems with the manuscript currently is that the objective of the study is not very clear due to inconsistent wording/framing. For example, the title frames the study as a report of diversity and biogeography of T4 bacteriophages associated with the bacterial fractions from samples collected in Lake Baikal. The abstract then frames the study as a comparison of bacterial fraction-associated bacteriophage communities across sample locations and types (i.e. viral fraction, biofilms) in Lake Baikal. The final paragraph of the introduction states that the investigators are comparing viral diversity across sample types (viral fraction, bacterial fraction, non-fractionated) along with a comparison of viral diversity at different locations in Lake Baikal which will then be compared to diversity seen in other ecosystems (Lines 93-97). Given these differences in framing, it is unclear what content to expect in the methods, results and discussion sections. There are also sections of text that seem to be broken up, for example, there are several lines throughout the manuscript that are not attached to any paragraph (see lines 46-48, 340-343, 344-346, 347-348, 349-351, 386-390). In addition, there are a lack of in-text citations to Figures and Tables which makes it very difficult for the reader to interpret the results and discussion points presented. Finally, the methods described in the manuscript are lacking detail, and several sections should be reorganized and revised to allow the reader to better follow what is being reported/discussed. For these reasons and given the fact that I find that the general premise of the study to be promising, I recommend that the authors substantially revise the manuscript so that it is clearly framed in one way and follows that framing throughout the entire manuscript. Below are specific comments to certain sections of the manuscript:

Abstract
General comments -

There is plenty of space (currently 135/500 words and 850/3000 characters used) for the addition of a few more sentences providing details like the reason for the work, novelty of work, number of samples taken/how they were collected, type of samples (surface water vs water from depth), sequence processing (clustering %), etc. I believe a sentence for the motivation of the study and its design is missing. Overall, the manuscript would benefit from a more descriptive abstract to give the reader a good synopsis of what is being tested/reported in the paper.

Specific comments -

Lines 19-21 – An introduction sentence(s) prior to this one would benefit the abstract. Rough example: “Lake Baikal phage communities are important for lake functioning. Here we look to describe the diversity of T4-bacteriophage associated with the bacterial fraction of filtered water samples collected from pelagic zone, coastal zone and shallow bays. Phage communities were probed using amplicon sequencing methods targeting the major capsid protein (gp23) and compared phylogenetically across sample locations and with sequences previously retrieved from non-bacterial fractions (<0.2 um) and biofilms (non-fractionated).”
Line 21 – “High throughput sequencing…”; This sentence describes the number of sequences recovered with the sequencing approach but should specify here the use of amplicon vs metagenomic sequencing (see above). Also, number of samples would be a nice addition to this sentence.

Lines 22-25 – Clarify if these sequences were published previously or are these from the same samples as mentioned previously?
Line 27 – Replace “most” with percent of OTUs and provide total number of OTUs identified (could be done in a previous sentence).


Introduction
General comments –
This introduction would benefit greatly from reorganization and the addition of background information more complementary to the objective of the study. While the information within lines 31-48 is interesting, it is not necessarily helpful for the reader to interpret what is being done in the study. Information similar to what is within lines 60-92 would fit better towards the beginning of the introduction providing useful background information about the role of bacteriophages in lake ecosystems while giving insight into the motivation of the study. The objectives listed in the final paragraph should be more evident in other sections of the paper, for example, from this final paragraph it seems the goal of the study is to compare the virus diversity across different fractions from the same sample, however, this is not mentioned in the methods, results or discussion.

Specific comments -
Line 33-32 – replace “huge number” with “their high abundance”

Line 38-39 – I think the sentence starting on line 39 could be appended to the sentence ending in line 38.
Line 49-50 – Revise sentence to “Due to lack of universal genes in viruses, signature genes for specific groups are targeted using group-specific primers.”

Experimental design

General comments -

I believe the manuscript would benefit from more a more descriptive methods section with justification of certain decisions (e.g. keeping primers on amplicon sequences) made in the analysis/experimental design. A major concern for the experimental design is the lack of replication at most sites which worries me when it comes to a comparison of diversity between locations. A few other major comments for each section:

Section 1 – Sampling sites
- Please revise this paragraph with additional details like total number of samples collected and how many per site. Also, it would benefit the results section if there was a little more description of the sampling sites themselves and what makes them different (might make discussing the water chemistry results easier later in the manuscript). For example, adding sentences like “There were two Lake Baikal bays, one coastal zone and one pelagic zone sampled in this study…” would very much help when discussing differences across samples later on in the manuscript.
- Coordinates for sample locations should be included in the main manuscript and could be included in the text within this section or in a more descriptive caption for Figure 1.
- In Figure 1, please make color of land and water consistent for each map. Currently the land in the map of Russia is dark grey, the other parts of the figure have land in a light grey and the water in a dark grey. Also, Figure 1 contains acronyms for sample sites, I recommend adding a more descriptive caption defining acronyms to make it easier for the reader to digest experimental design.
Section 2 – Water chemistry
- This section could be moved to after sections 3 and 4 to help with flow of methods overall.

Section 3 - DNA extraction and preparation of amplicons
- The final paragraph in the introduction mentions the comparison across multiple sample types, although this section only mentions the generation and extraction from the bacterial fraction from the samples.

Section 4 – Bioinformatic analysis
- Please be clearer in this section, expand specifically on how the analysis was done, for example, were merged reads pooled from each sample prior to dereplicating/clustering or was each sample analyzed separately.
- Another way to improve in this section would be to reorder the text a little bit, first describing all nucleotide-based analyses then all amino acid-based analyses
- I would also recommend describing within this section or adding a table with descriptions of the datasets that were compared to in this study.
- It is not recommended to keep primers on amplicon sequences. While virus primers are generally more degenerate than bacterial primers, primer mismatch can occur and thus the information in these areas could be false (see Lefever et al. 2013, https://doi.org/10.1373/clinchem.2013.203653)
- Overall, the level of detail in this section does not allow for easy reproducibility of the analyses. A potentially useful tool for virus amplicon sequencing analysis is the program vAMPirus (https://github.com/Aveglia/vAMPirus).

Validity of the findings

Please rearrange the sections within the results to allow the reader to follow along easier, for example, water chemistry and the NMDS looking at the physical parameters and bacteriophage community composition may be more appropriate after describing the differences in diversity observed at each site. In-text citations to Figures and Tables that display the results being presented/discussed would also greatly aid the ability of the reader to appreciate the findings. Overall, the impact of these results and discussion section is hindered by the variable framing/objectives of the study along with an underdeveloped methods section. I believe if these areas were worked on further, the results and discussion would benefit significantly.

Also, I thank the authors for the representative sequence fasta file provided, however, instructions for how to access raw amplicon sequencing data for this project should be added in the next version of the paper.

Additional comments

no comment

All text and materials provided via this peer-review history page are made available under a Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.